// ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/common/unicode.js const UNDEFINED_CODE_POINTS = /* @__PURE__ */ new Set([ 65534, 65535, 131070, 131071, 196606, 196607, 262142, 262143, 327678, 327679, 393214, 393215, 458750, 458751, 524286, 524287, 589822, 589823, 655358, 655359, 720894, 720895, 786430, 786431, 851966, 851967, 917502, 917503, 983038, 983039, 1048574, 1048575, 1114110, 1114111 ]); var CODE_POINTS; (function(CODE_POINTS) { CODE_POINTS[CODE_POINTS["EOF"] = -1] = "EOF"; CODE_POINTS[CODE_POINTS["NULL"] = 0] = "NULL"; CODE_POINTS[CODE_POINTS["TABULATION"] = 9] = "TABULATION"; CODE_POINTS[CODE_POINTS["CARRIAGE_RETURN"] = 13] = "CARRIAGE_RETURN"; CODE_POINTS[CODE_POINTS["LINE_FEED"] = 10] = "LINE_FEED"; CODE_POINTS[CODE_POINTS["FORM_FEED"] = 12] = "FORM_FEED"; CODE_POINTS[CODE_POINTS["SPACE"] = 32] = "SPACE"; CODE_POINTS[CODE_POINTS["EXCLAMATION_MARK"] = 33] = "EXCLAMATION_MARK"; CODE_POINTS[CODE_POINTS["QUOTATION_MARK"] = 34] = "QUOTATION_MARK"; CODE_POINTS[CODE_POINTS["AMPERSAND"] = 38] = "AMPERSAND"; CODE_POINTS[CODE_POINTS["APOSTROPHE"] = 39] = "APOSTROPHE"; CODE_POINTS[CODE_POINTS["HYPHEN_MINUS"] = 45] = "HYPHEN_MINUS"; CODE_POINTS[CODE_POINTS["SOLIDUS"] = 47] = "SOLIDUS"; CODE_POINTS[CODE_POINTS["DIGIT_0"] = 48] = "DIGIT_0"; CODE_POINTS[CODE_POINTS["DIGIT_9"] = 57] = "DIGIT_9"; CODE_POINTS[CODE_POINTS["SEMICOLON"] = 59] = "SEMICOLON"; CODE_POINTS[CODE_POINTS["LESS_THAN_SIGN"] = 60] = "LESS_THAN_SIGN"; CODE_POINTS[CODE_POINTS["EQUALS_SIGN"] = 61] = "EQUALS_SIGN"; CODE_POINTS[CODE_POINTS["GREATER_THAN_SIGN"] = 62] = "GREATER_THAN_SIGN"; CODE_POINTS[CODE_POINTS["QUESTION_MARK"] = 63] = "QUESTION_MARK"; CODE_POINTS[CODE_POINTS["LATIN_CAPITAL_A"] = 65] = "LATIN_CAPITAL_A"; CODE_POINTS[CODE_POINTS["LATIN_CAPITAL_Z"] = 90] = "LATIN_CAPITAL_Z"; CODE_POINTS[CODE_POINTS["RIGHT_SQUARE_BRACKET"] = 93] = "RIGHT_SQUARE_BRACKET"; CODE_POINTS[CODE_POINTS["GRAVE_ACCENT"] = 96] = "GRAVE_ACCENT"; CODE_POINTS[CODE_POINTS["LATIN_SMALL_A"] = 97] = "LATIN_SMALL_A"; CODE_POINTS[CODE_POINTS["LATIN_SMALL_Z"] = 122] = "LATIN_SMALL_Z"; })(CODE_POINTS || (CODE_POINTS = {})); const SEQUENCES = { DASH_DASH: "--", CDATA_START: "[CDATA[", DOCTYPE: "doctype", SCRIPT: "script", PUBLIC: "public", SYSTEM: "system" }; function isSurrogate(cp) { return cp >= 55296 && cp <= 57343; } function isSurrogatePair(cp) { return cp >= 56320 && cp <= 57343; } function getSurrogatePairCodePoint(cp1, cp2) { return (cp1 - 55296) * 1024 + 9216 + cp2; } function isControlCodePoint(cp) { return cp !== 32 && cp !== 10 && cp !== 13 && cp !== 9 && cp !== 12 && cp >= 1 && cp <= 31 || cp >= 127 && cp <= 159; } function isUndefinedCodePoint(cp) { return cp >= 64976 && cp <= 65007 || UNDEFINED_CODE_POINTS.has(cp); } // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/common/error-codes.js var ERR; (function(ERR) { ERR["controlCharacterInInputStream"] = "control-character-in-input-stream"; ERR["noncharacterInInputStream"] = "noncharacter-in-input-stream"; ERR["surrogateInInputStream"] = "surrogate-in-input-stream"; ERR["nonVoidHtmlElementStartTagWithTrailingSolidus"] = "non-void-html-element-start-tag-with-trailing-solidus"; ERR["endTagWithAttributes"] = "end-tag-with-attributes"; ERR["endTagWithTrailingSolidus"] = "end-tag-with-trailing-solidus"; ERR["unexpectedSolidusInTag"] = "unexpected-solidus-in-tag"; ERR["unexpectedNullCharacter"] = "unexpected-null-character"; ERR["unexpectedQuestionMarkInsteadOfTagName"] = "unexpected-question-mark-instead-of-tag-name"; ERR["invalidFirstCharacterOfTagName"] = "invalid-first-character-of-tag-name"; ERR["unexpectedEqualsSignBeforeAttributeName"] = "unexpected-equals-sign-before-attribute-name"; ERR["missingEndTagName"] = "missing-end-tag-name"; ERR["unexpectedCharacterInAttributeName"] = "unexpected-character-in-attribute-name"; ERR["unknownNamedCharacterReference"] = "unknown-named-character-reference"; ERR["missingSemicolonAfterCharacterReference"] = "missing-semicolon-after-character-reference"; ERR["unexpectedCharacterAfterDoctypeSystemIdentifier"] = "unexpected-character-after-doctype-system-identifier"; ERR["unexpectedCharacterInUnquotedAttributeValue"] = "unexpected-character-in-unquoted-attribute-value"; ERR["eofBeforeTagName"] = "eof-before-tag-name"; ERR["eofInTag"] = "eof-in-tag"; ERR["missingAttributeValue"] = "missing-attribute-value"; ERR["missingWhitespaceBetweenAttributes"] = "missing-whitespace-between-attributes"; ERR["missingWhitespaceAfterDoctypePublicKeyword"] = "missing-whitespace-after-doctype-public-keyword"; ERR["missingWhitespaceBetweenDoctypePublicAndSystemIdentifiers"] = "missing-whitespace-between-doctype-public-and-system-identifiers"; ERR["missingWhitespaceAfterDoctypeSystemKeyword"] = "missing-whitespace-after-doctype-system-keyword"; ERR["missingQuoteBeforeDoctypePublicIdentifier"] = "missing-quote-before-doctype-public-identifier"; ERR["missingQuoteBeforeDoctypeSystemIdentifier"] = "missing-quote-before-doctype-system-identifier"; ERR["missingDoctypePublicIdentifier"] = "missing-doctype-public-identifier"; ERR["missingDoctypeSystemIdentifier"] = "missing-doctype-system-identifier"; ERR["abruptDoctypePublicIdentifier"] = "abrupt-doctype-public-identifier"; ERR["abruptDoctypeSystemIdentifier"] = "abrupt-doctype-system-identifier"; ERR["cdataInHtmlContent"] = "cdata-in-html-content"; ERR["incorrectlyOpenedComment"] = "incorrectly-opened-comment"; ERR["eofInScriptHtmlCommentLikeText"] = "eof-in-script-html-comment-like-text"; ERR["eofInDoctype"] = "eof-in-doctype"; ERR["nestedComment"] = "nested-comment"; ERR["abruptClosingOfEmptyComment"] = "abrupt-closing-of-empty-comment"; ERR["eofInComment"] = "eof-in-comment"; ERR["incorrectlyClosedComment"] = "incorrectly-closed-comment"; ERR["eofInCdata"] = "eof-in-cdata"; ERR["absenceOfDigitsInNumericCharacterReference"] = "absence-of-digits-in-numeric-character-reference"; ERR["nullCharacterReference"] = "null-character-reference"; ERR["surrogateCharacterReference"] = "surrogate-character-reference"; ERR["characterReferenceOutsideUnicodeRange"] = "character-reference-outside-unicode-range"; ERR["controlCharacterReference"] = "control-character-reference"; ERR["noncharacterCharacterReference"] = "noncharacter-character-reference"; ERR["missingWhitespaceBeforeDoctypeName"] = "missing-whitespace-before-doctype-name"; ERR["missingDoctypeName"] = "missing-doctype-name"; ERR["invalidCharacterSequenceAfterDoctypeName"] = "invalid-character-sequence-after-doctype-name"; ERR["duplicateAttribute"] = "duplicate-attribute"; ERR["nonConformingDoctype"] = "non-conforming-doctype"; ERR["missingDoctype"] = "missing-doctype"; ERR["misplacedDoctype"] = "misplaced-doctype"; ERR["endTagWithoutMatchingOpenElement"] = "end-tag-without-matching-open-element"; ERR["closingOfElementWithOpenChildElements"] = "closing-of-element-with-open-child-elements"; ERR["disallowedContentInNoscriptInHead"] = "disallowed-content-in-noscript-in-head"; ERR["openElementsLeftAfterEof"] = "open-elements-left-after-eof"; ERR["abandonedHeadElementChild"] = "abandoned-head-element-child"; ERR["misplacedStartTagForHeadElement"] = "misplaced-start-tag-for-head-element"; ERR["nestedNoscriptInHead"] = "nested-noscript-in-head"; ERR["eofInElementThatCanContainOnlyText"] = "eof-in-element-that-can-contain-only-text"; })(ERR || (ERR = {})); // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/tokenizer/preprocessor.js const DEFAULT_BUFFER_WATERLINE = 65536; var Preprocessor = class { constructor(handler) { this.handler = handler; this.html = ""; this.pos = -1; this.lastGapPos = -2; this.gapStack = []; this.skipNextNewLine = false; this.lastChunkWritten = false; this.endOfChunkHit = false; this.bufferWaterline = DEFAULT_BUFFER_WATERLINE; this.isEol = false; this.lineStartPos = 0; this.droppedBufferSize = 0; this.line = 1; this.lastErrOffset = -1; } /** The column on the current line. If we just saw a gap (eg. a surrogate pair), return the index before. */ get col() { return this.pos - this.lineStartPos + Number(this.lastGapPos !== this.pos); } /** The index in `html` at which the current code point starts (the high surrogate of a pair). */ get codePointStart() { return this.pos - Number(this.lastGapPos === this.pos); } /** The offset of the current code point, before the second unit of a surrogate pair. */ get offset() { return this.droppedBufferSize + this.codePointStart; } getError(code, cpOffset) { const { line, col, offset } = this; const startCol = col + cpOffset; const startOffset = offset + cpOffset; return { code, startLine: line, endLine: line, startCol, endCol: startCol, startOffset, endOffset: startOffset }; } _err(code) { if (this.handler.onParseError && this.lastErrOffset !== this.offset) { this.lastErrOffset = this.offset; this.handler.onParseError(this.getError(code, 0)); } } _addGap() { this.gapStack.push(this.lastGapPos); this.lastGapPos = this.pos; } _processSurrogate(cp) { if (this.pos !== this.html.length - 1) { const nextCp = this.html.charCodeAt(this.pos + 1); if (!isSurrogatePair(cp) && isSurrogatePair(nextCp)) { this.pos++; this._addGap(); return getSurrogatePairCodePoint(cp, nextCp); } } else if (!this.lastChunkWritten) { this.endOfChunkHit = true; return CODE_POINTS.EOF; } this._err(ERR.surrogateInInputStream); return cp; } willDropParsedChunk() { return this.pos > this.bufferWaterline; } /** * Drop the parsed input, except for the current code point and the `keep` code units before it. The gap history is * reset, so the kept units must contain no preprocessing gap. */ dropParsedChunk(keep = 0) { if (this.willDropParsedChunk()) { const droppedSize = this.offset - this.droppedBufferSize - keep; this.html = this.html.substring(droppedSize); this.lineStartPos -= droppedSize; this.droppedBufferSize += droppedSize; this.pos -= droppedSize; this.lastGapPos = -2; this.gapStack.length = 0; if (this.pos > keep) this._addGap(); } } write(chunk, isLastChunk) { if (this.html.length > 0) this.html += chunk; else this.html = chunk; this.endOfChunkHit = false; this.lastChunkWritten = isLastChunk; } insertHtmlAtCurrentPos(chunk) { this.html = this.html.substring(0, this.pos + 1) + chunk + this.html.substring(this.pos + 1); this.endOfChunkHit = false; } startsWith(pattern, caseSensitive) { if (this.pos + pattern.length > this.html.length) { this.endOfChunkHit = !this.lastChunkWritten; return false; } if (caseSensitive) return this.html.startsWith(pattern, this.pos); for (let i = 0; i < pattern.length; i++) if ((this.html.charCodeAt(this.pos + i) | 32) !== pattern.charCodeAt(i)) return false; return true; } peek(offset) { const pos = this.pos + offset; if (pos >= this.html.length) { this.endOfChunkHit = !this.lastChunkWritten; return CODE_POINTS.EOF; } const code = this.html.charCodeAt(pos); return code === CODE_POINTS.CARRIAGE_RETURN ? CODE_POINTS.LINE_FEED : code; } advance() { this.pos++; if (this.isEol) { this.isEol = false; this.line++; this.lineStartPos = this.pos; } if (this.pos >= this.html.length) { this.endOfChunkHit = !this.lastChunkWritten; return CODE_POINTS.EOF; } let cp = this.html.charCodeAt(this.pos); if (cp === CODE_POINTS.CARRIAGE_RETURN) { this.isEol = true; this.skipNextNewLine = true; return CODE_POINTS.LINE_FEED; } if (cp === CODE_POINTS.LINE_FEED) { this.isEol = true; if (this.skipNextNewLine) { this.line--; this.skipNextNewLine = false; this._addGap(); return this.advance(); } } this.skipNextNewLine = false; if (isSurrogate(cp)) cp = this._processSurrogate(cp); if (!(this.handler.onParseError === null || cp > 31 && cp < 127 || cp === CODE_POINTS.LINE_FEED || cp === CODE_POINTS.CARRIAGE_RETURN || cp > 159 && cp < 64976)) this._checkForProblematicCharacters(cp); return cp; } _checkForProblematicCharacters(cp) { if (isControlCodePoint(cp)) this._err(ERR.controlCharacterInInputStream); else if (isUndefinedCodePoint(cp)) this._err(ERR.noncharacterInInputStream); } retreat(count) { this.pos -= count; while (this.pos < this.lastGapPos) { this.lastGapPos = this.gapStack.pop(); this.pos--; } this.isEol = false; } }; // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/common/token.js var TokenType; (function(TokenType) { TokenType[TokenType["CHARACTER"] = 0] = "CHARACTER"; TokenType[TokenType["NULL_CHARACTER"] = 1] = "NULL_CHARACTER"; TokenType[TokenType["WHITESPACE_CHARACTER"] = 2] = "WHITESPACE_CHARACTER"; TokenType[TokenType["START_TAG"] = 3] = "START_TAG"; TokenType[TokenType["END_TAG"] = 4] = "END_TAG"; TokenType[TokenType["COMMENT"] = 5] = "COMMENT"; TokenType[TokenType["DOCTYPE"] = 6] = "DOCTYPE"; TokenType[TokenType["EOF"] = 7] = "EOF"; TokenType[TokenType["HIBERNATION"] = 8] = "HIBERNATION"; })(TokenType || (TokenType = {})); function getTokenAttr(token, attrName) { for (let i = token.attrs.length - 1; i >= 0; i--) if (token.attrs[i].name === attrName) return token.attrs[i].value; return null; } // ../../node_modules/.pnpm/entities@9.0.0/node_modules/entities/dist/decode-codepoint.js /** * C1 Unicode control character reference replacements (code points 128-159). * Index i gives the replacement for code point 128+i; 0 means "no replacement". */ const c1 = [ 8364, 0, 8218, 402, 8222, 8230, 8224, 8225, 710, 8240, 352, 8249, 338, 0, 381, 0, 0, 8216, 8217, 8220, 8221, 8226, 8211, 8212, 732, 8482, 353, 8250, 339, 0, 382, 376 ]; /** * True for NUL, UTF-16 surrogates, and values past U+10FFFF. * @param codePoint Unicode code point to check. */ function isInvalidCodePoint(codePoint) { return codePoint === 0 || codePoint >= 55296 && codePoint <= 57343 || codePoint > 1114111; } /** * Replace the given code point with U+FFFD if it is NUL (0), a surrogate, or * outside the valid Unicode range. Code points in the C1 controls range * (128-159) are remapped to their Windows-1252 equivalents, following the * HTML spec. All other code points are returned unchanged. * @param codePoint Unicode code point to convert. */ function replaceCodePoint(codePoint) { if (isInvalidCodePoint(codePoint)) return 65533; if (codePoint >= 128 && codePoint <= 159) return c1[codePoint - 128] || codePoint; return codePoint; } // ../../node_modules/.pnpm/entities@9.0.0/node_modules/entities/dist/generated/decode-data-html.js /** * Serialized decode data; the format is documented in * `src/internal/decode-data-format.ts`. `[0]` is one-byte data (all char * codes <= 0xFF: header, front-coded name suffixes, per-name metadata, * cuckoo choice bits); `[1]` holds the replacement values. */ const htmlDecodeData = ["Q=¨`p0AEligMPacutebrevecircyfrgravelphamacrndogonpfpplyFunctionringscrsigntildeumlBackslashrvwedcyecausernoullistafropfrevescrumpeqCHcyOPYacutepitalDifferentialDyleyscaronedilirconintdotedillanterDotfrhiircleDotMinusPlusTimeslockwiseContourIntegralseCurlyDoubleQuoteQuoteolonengruentinttourIntegralpfroductunterClockwiseContourIntegralrossscrupCapDDotrahdJcyScyZcyaggerrrshvcaronyeltafriacriticalAcuteDotubleAcuteGraveTildemondfferentialDopftDotEqualubleContourIntegralDotwnArrowLeftArrowRightArrowTeeongLeftArrowRightArrowRightArrowRightArrowTeeUpArrowDownArrowVerticalBarwnArrowBarUpArrowBreveLeftRightVectorTeeVectorVectorBarRightTeeVectorVectorBarTeeArrowarrowscrtrokENGTHacutecaronircydotfrgravelementmacrptySmallSquareVerySmallSquareogonpfpsilonqualTildeilibriumscrimtaumlxistsponentialEFcyfrilledSmallSquareVerySmallSquareopfrAlluriertrfscrGJcyTammadbrevecedilircydotfrgopfreaterEqualLessFullEqualGreaterLessSlantEqualTildescrtHARDcyacektcircfrilbertSpaceopfrizontalLinescrtrokumpDownHumpEqualIEcyJligOcyacutecircydotfrgravemacrginaryIpliesntegralrsectionvisibleCommaTimesogonpftascrtildeukcymlJcircyfropfscrercyukcyKHcyJcyappacedilyfropfscrLJcyTacutembdangplacetrfrrcaronedilyeftAngleBracketrrowBarRightArrowCeilingDoubleBracketwnTeeVectorVectorBarFloorRightArrowVectorTeeArrowVectorriangleBarEqualUpDownVectorTeeVectorVectorBarVectorBararrowrightarrowssEqualGreaterFullEqualGreaterLessSlantEqualTildefrleftarrowmidotongLeftArrowRightArrowRightArrowleftarrowrightarrowrightarrowpfwerLeftArrowRightArrowscrhtroktMapcyediumSpacellintrffrinusPlusopfscruNJcyacutecaronedilyegativeMediumSpaceThickSpacenSpaceVeryThinSpacestedGreaterGreaterLessLesswLinefroBreaknBreakingSpacepftCongruentupCapDoubleVerticalBarElementqualTildexistsGreaterEqualFullEqualGreaterLessSlantEqualTildeHumpDownHumpEqualLeftTriangleBarEqualssEqualGreaterLessSlantEqualTildeNestedGreaterGreaterLessLessPrecedesEqualSlantEqualReverseElementightTriangleBarEqualSquareSubsetEqualpersetEqualubsetEqualcceedsEqualSlantEqualTildepersetEqualTildeEqualFullEqualTildeVerticalBarscrtildeuOEligacutecircydblacfrgravemacregaicronopfpenCurlyDoubleQuoteQuoterscrlashtildemesumlverBarraceketParenthesisPartialDcyfrhiilusMinusoincareplanepfrecedesEqualSlantEqualTildeimeoductportionalscriQUOTfropfscrRBarrEGacutengrrtlcaronedilyeverseElementquilibriumUpEquilibriumfrhoightAngleBracketrrowBarLeftArrowCeilingDoubleBracketwnTeeVectorVectorBarFloorTeeArrowVectorriangleBarEqualUpDownVectorTeeVectorVectorBarVectorBararrowopfundImpliesrightarrowscrhuleDelayedSHCHcycyOFTcyacutecaronedilircyfrhortDownArrowLeftArrowRightArrowUpArrowigmamallCircleopfqrtuareIntersectionSubsetEqualpersetEqualUnionscrtarubsetEqualcceedsEqualSlantEqualTildehThatmpersetEqualsetTHORNRADESHcycyabucaronedilyfrhereforetaickSpacenSpaceildeEqualFullEqualTildeopfripleDotscrtrokUacuterrocirbrcyevecircydblacfrgravemacrnderBarraceketParenthesisionPlusogonpfpArrowBarDownArrowDownArrowEquilibriumTeeArrowarrowdownarrowperLeftArrowRightArrowsilonringscrtildeumlVDashbarcydashleerbarticalBarLineSeparatorTildeyThinSpacefropfscrvdashWcircedgefropfscrXfriopfscrYAcyIcyUcyacutecircyfropfscrumlZHcyacutecaronydoteroWidthSpacetafropfscraacutebrevecEdircuteyeligfrgravelefsymphphamacrlgpndanddslopevgelemsdaabcdefghrtvbdsphtzarrogonpfpEacireidosproxeqringscrtympeqtildeumlwconintintbNotackcongepsilonprimesimeqrveewedgebrktbrkcongydquoecausemptyvpsirnoutahweenfrigcapircupodotplustimessqcuptartriangledownupuplusveewedgekarowlacklozengesquaretriangledownleftrightnkk12434ocknequivotopfttomwtiexDLRlrHDUduULRlrVHLRhlrboxdLRlrhDUduminusplustimesuLRlrvHLRhlrprimerevevbarscremiimeolbhsubulletmpEeqcacutepandbrcupcapupdotsretoncapsronedilircupssmdotedilmptyvnterdotfrhcyeckmarkiirEceqlearrowleftrightdRSastcircdashefnintmidscirlubsuitoloneqmmatpfnlementxesngdotintpfrodysrrarrossscrubepetdotudarrlreprsclarrppbrcapcapupdotorsrarrmlyeqprecsuccveewedgerenvearrowleftrightveewedwconintintylctydArrHaraggerlethrrshvbkarowlaccaronydaggerrrotseqegltamptyvfishtrharlriamondsuitsegammasinvideontimesonxjcylcornropollarpfteqdotminusplussquareublebarwedgewnarrowdownarrowsharpoonleftrightrbkarowcornropscryoltroktdotrifuarrharwanglezcyigrarreDDototacutestercaronircolonydotefDotrgravesdotlinterslsdotmacrptysetvsp134ngspogonpfparsllussilonvqcircolonsimlantgtrlessualsestivDDvparslrDotarrscrdotimtahumlroxclistpectationonentialefallingdotseqcyemalefiligligligriligjliglatligtnsnofopfrallkvpartintrac123456823534584556878slownscrgElacutemmadpbrevecircydotelqqslantsccdotollesfrggimeljcylEajnEapproxeqqsimopfravescrimeltccirdotlParquestrapproxrrdoteqlessqlesslesssimvertneqqnEhArrairsplfmiltrdcyrcirwbarcirceartsuitlliprconfrksearowwarowoarrmthtokleftarrowrightarrowpfrbarscrlashtrokybullpheniacutecircyecyxclffrgraveiiintntnfinotajligmacrgelinepartthofpedncarefintieodottcalegersrcallarhkprodocygonpftaprodquestscrinEdotsvvtildeukcymljcircyfrmathopfscrercyukcykappavcedilyfrgreenhcyjcyopfscrlAarrrrtailBarrEgHaracuteemptyvgranmbdangdlepquorrbfsfshklpplsimtltailesbarrbrkracekkeslducaronedililubydcaquorrdharusharsheftarrowtailharpoondownupleftarrowsrightarrowsharpoonssquigarrowthreetimesgqqslantsccdotorgessapproxdoteqgtrqgtrgtrsimfishtloorrgEhardulblkjcylarrcornerhardtrimidotoustachenEapproxeqqsimoangrrbrkngleftarrowrightarrowmapstorightarrowoparrowleftrightparflustimeswastbarzengefparltrarrcornerhardmtrisaquocrhimegqbuortroktccirdothreeimeslarrquestrPariefurdsharuharvertneqqnEmDDotacrletesepstodownleftuprkercommaydasheasuredanglefrhoicrodastcirdotnusbdulcpdrnplusodelspfpscrtposultimapmapnGgtvLeftarrowrightarrowltvRightarrowVDashdashablacutengpEidosproxturalsbspumpecapronedilongdotupydasheArrarhkrowdotquivsearimxistsfrgEeqqslantssimtrhArrarrparisdvjcylArrEarrdreftarrowrightarrowqqslantsssimtriemidopftinEdotvabcnivabcparallelsltolintrcueeceqrArrarrcwightarrowtriesccueerhortmidparallelimeqmidparqsubepeubEeseteqqcceqpEeseteqqtglildelgrianglelefteqrightequmerospvDashHarrapdashgetinfinlArretrierArrtriesimwArrarhkrownearoSacutestcircydashblacivotsoldeligfcirrgonravethbarmintlarrcirrossinetmacregaicrondnusopfparerplusrarrderoffmigoforslopevscrlasholtildemesasumlvbarparallelsimltcyercntiodmilptenkfrhivmmatoneitchforkvlanckhkvusacirbcirdouemnsimtwomointintpfundrEapcueecapproxcurlyeqeqnapproxeqqsimsimimesnEapsimodfalarlinesurfptosimurelscriuncspqfrintopfprimescruaternionsintesteqotrAarrrrtailBarrHaraceutedicemptyvngdelequorrapbfscfshklpplsimtlwtailionalsbarrbrkracekkeslducaronedililubydcaldharquorshealinepartsctgfishtloorrhardulovightarrowtailharpoondownupleftarrowsharpoonsrightarrowssquigarrowthreetimesngsingdotseqlarrharmmoustachenmidoangrrbrkparflustimespargtpolintrarrsaquocrhqbuorthreeimesriefltriuluharxsacutebquocEaproncueedilircnEapsimpolintsimydotbeeArrarhkrowctmiswartminusnxtfrownharpchcyyortmidparallelyigmafvmdoteqgElEneplusrarrlarrmallsetminusshpeparslidletesoftcylbarpfpadesuitrqcapsupssubeseteqpesetequareffrarrscretmnmiletarftarfraightepsilonphinsubEdotedotmultnEeplusrarrseteqqneqqimubpccapproxcurlyeqeqnapproxeqqsimsimmngp123EdotsubedothsolublarrmultnEeplusseteqqneqqimubpwArrarhkrownwarzligtargetubrkcaronedilydotelrecfrhere4foretasymvickapproxsimnspkapsimornildemesbardntoeapbotcirforksaprimeradeiangledownlefteqqrighteqdoteminusplussbtimepeziumscryhcytrokwixtoheadleftarrowrightarrowuArrHaracuterrbrcyevecircydarrblacharfishtrgraveharlrblklcornerroptrimacrlogonpfparrowdownarrowharpoonleftrightlussihlonuparrowsrcornerropingtriscrtdotilderifuarrmlwanglevArrBarvDashangrtrepsilonkappanothingphiiroptorhosigmaubsetneqqpsetneqqthetariangleleftrightcydasheebareqlliprbartfrltrinsubpopfproprtriscrubnEepnEezigzagwcircedbargeqierpfropfpreathscrxcapircupdtrifrhArrarrilArrarrmapnisodotpflustimerArrarrscrqcupuplustriveewedgeyacuteycircyenfricyopfscrucymlzacutecaronydoteetrftafrhcyigrarropfscrwjnjC(D%D($(D'%$$ED($'$'$%$'%E$/D'$F%'D(D&#,%%&&$%$)%+%%$E$F$'$&$(#'D&$(%$&4%($(E'%&%($&$)%*$%$%$+)()')($:&5-($'($%*&&&/%%&)%@$'$F$%&&#%%)$&$&$&$(%%%&$(%$$%&%$E$2.&0,.(.(&'%.$F%$&&&(%6)&+*),---&*/1---)-.&)*+,).%*,&,*'('2+,+)1&'1,)2&'&*('($F%'#&D%D($(E&%$$&$ED($)$'%1(2$'%E$)$'((&+$&%%$%D&$(%-#&$E$3)2$F%'%+$&#'D$$'($$($(%&%$$&$E$$$F$./'*,***'*-*($F$$#)$'%$$'$%$.$&%/$&%'$.'(#'$'$&D(D'%$$&$%D($$%&&*%($%&('+%/,($'%E%%$&$($'E%#(%$$E$F$F%'$'#'$&$'$(%$$E$F$F#'D$$(%'%%%+%%$(%'%$$2(',&,-'*'0).+)1&'('-,)'&*(*)(*/&/('/),))/&')-&'('-%1','*'''-'($E$$%+$($/+-'-',+-'-%E%/(-$&%$%'$$#&$%$-%*$E$+$F$&$$#'$($(%'%$$5+-.)+0%5)+%($E$)%1%%%$&,'(&4&*''+H'(&*-(-L-J-'-M-(&O*H&/2F2((%*(***G*M*(&W,K&+.H.-&1'/3F3(&O2(.I4('H,(().H.-.H(I.(&(+(+,+(&.$FD($$#(D(D'%$$($ED($'%&%($F$6,($$$FE'D(&&D&$)('+&'.#+$%$E$%$$$+$/%%$$%)+(+-+(%&%(&*-%$F%$C'$E$&$F#(D%$(%%%%'%$(%'%$$$%/+-*0$%$%$3)'-&-,(*(0*.,)2&(((&+(+))*0&0((/*,*)0&().&(($&%-$-$&%$$-#)%%$($($$%'%'%&%$$E$0(,(-(*$'$-$F$&%')/))/(+)1()($F$&$%&&)(%)+(+-+(&(%$%$&(+(&&C($'$'%%$%%$$(%'%$$E$+&%%K&)$'(((,(($F$+$F%'C)%%''$'&&D'%$$($ED($'$*)',&(.%&('$'%E$)*&*,%,%.%&((%(%,%/(-%%'&$'$F$(D&#($&$%$'($$%%'&$'*+'+,+(&-$E$F$F$(#($'$E$F$F#F$$$F$F#'$&$&D($'%$$E$F$F$&#'$($(%$$&$0%%$%$&$FC)$($$%D%$E&E&%$D'$$%DD($)&%%&$'&%E$$%&&&$&(&$%$&$&%&&)%*$*$*$*$*$*$*$&%(%*$&&'$&'$'%E$$%$%'%$%%%%%')%D'$F%$%&(%D(D&$*%&#'$*'*'('&*%%'&&)%$&''$'%$$'$()$%(%&%'%%&$&'$E$('&'%&''''(&('&&/.%&(&&&($($.()(+0'0'0(&%%&'$&%%&$E&G%%$F%$&&%'%&'$'$'$&$'$'$'$'$&%'$'$'$&$'$'$'$'$'$'$&&&%'$'$'$&$'$'$'$'$&(&'&(&%'$'$'$&$'$'$'$'$'$'$$($'E'$F%&%%'$%%'$''$&'%%%'$'$($#)%$&&&(&&'%&&&D%&&%$'&&E'%&%&(%$&D'%(E%'($E$&%&('%$$%&$&$'%'..()%*$*&*'*'&$&(&&&'$'(&$'($)$%&($&$'%'))&%%'&&&%E&&F$'%$'%&$F%%'$&$'$$'$))$%&&%%')$%$&(&&'%&&&%&D%')$&+*'(&((F&&.-(%&%&$*%&$(#'$&$(%'%%%%'$$)%&$(%$$$%(&%%(D%%&%($(%D$''$$&'&*''$%$%(%&%$F&)*&&$&$(&&$(%E%$&%(&&(&'&)%/%*'-'..($*%'&&$F&$%%%'$'%%'$$'%&$)$&%)#(%%D(%'$(%%G$%'%$$&$$$'%D$$E'%$&&$$%)%$%$&&$'%&(&($%%'%($$%%%$'%E$&'%%&%%'&'$$(&'%&&**'%'&&&%(%%)$'%&$&%&%%$%E$D&%%$&%&%,&,#0$%$($(%&&&%D$'$G$&%&%&$&$F%'&$'$$*D(($H$($($($'%($G%($($'%'%($'%&%%&$F#%%$$(%&($%$$($'%$$&$$%$%$&$&(%$&%&&)$*$&D'%$E$$%$$'$&$$%$%$%$$%%%''%$&$'$%&$F$'$&%%'$'$D$%%&%%&%'%(%*'%&&&)((&'&&$K%E#'$(%%%'%'&$'&'$$&$'$()&%'%'$E$*&($'%'%.'-%E%'$F%'%'$(%'C)$$E&%$$&E&$%%DD($$%'&%%'%&$'$'&%''''&%%%%&$$%'%&(&%'%$&&&(''&(&'$&%&%E%%$'D($F%%'$'&'$($'$$$%'$'E%#(%$$E$'$F$F%'$'#(($$(%$$E$($&$&$F$F#(%%%'$'$$%$$&$(%)%'%'%%'$'%%$E&%%'$(%'%'%'%'%'&'%%$&&&$'D$'%&%'($&%'&)$$(%'&%%%%$$&%&($%(&(%%$$%*,''..%'-'-1$,+,-'-%$%$&$&(%$&%&&)$*$&D'%&*'&'()''&'&$(%'%D$$%$$''$($%&$&$$%&%)%'%&$(%')'$%%%''%$&$'$%&$'&%%&%.+-')'-%.,(%&&D&&%(%'&&%$&'&$$&'%$'%)%&($%$%&$(%E%$%%'$'$%%&%($%'D$%%&%%&%'%'%'%(%'&$'$'$$*&'$K%E#(D&%%&$'&%$&&)')')%%'$(%$$'$/$E$%D'%$&&&&F&%&($($)$$&%%$($(%E$$$F%'$$%)%&#F%D&D$,(-%D%D&D$-$(%'$'%'%E%$&D&E&%&'%&(%*$D&%F(D$&&&%'%&(F%%%$$'$$%&%''$(%%F%'%'&E%')$$E$E%$&$'D'H&D%&%$&$$'%&%&$$%$&$%$$&$'%D%&%%%$&*(-&$'D'H&D'$%&%$&%($$&$FE$&%(D(F(%)$)$&%(%)$)$$&'('E'D%(%$&&&D'$(E$'%&(D(D%,%&($$%&&&D&D%*)+%%'$($%&%&%((%%%'D'$'F*%,D&%(E&$'D'$'F*%,D$&E'%%%.0%,(1%$$%$&&&%$(%'%E%'%E&D%(%'&D&D'F%'&G%F$'%''$(%%'#%D(%%$&G$%$$'%'%%%%%'$'$'%D$&E'%$$'%$$&$'%&&'%&%$$'%&%(&$&&$F$&%&%&$$%&%$&%(%F$F$%'%%%(%$$&E'%%D(&&)%D&$'#&F$''&&'$&$$%$(&&&&&$&'$E$%&$%'%&$$%*%$$()$'%%%'''$'&'%($'$G%'&'&$$$*%EE&$$%$%%%&%$&$')'*'%'*(&(&'&%&($%%&%&&%%&(''''&$'%%&%'$F%$$(#F$&$F$($F$-'&%&(%E%#(%%%'$'$&$F&&%&%)%%'$'$'%E&%%'%'$(%'$'%'%'%'%'&'%'$%'&%('$'%&%'($&%'&)$$(%'&%%%%$$&%(%&($%%$&'&'''$%%E$$(%'%D$''$($%$&$$,-'(./%(-,+(.(-(-%%%-$'%&%$$()'$'$'&%%&%&&D&&%($&'%%)$'$(%E%$%%&%($$(%'%%'$'$''$)$$#)$'$$%$%%&&%&%$&&%&%%&%&&%)%&%$$&'$'$$'%''$(%E%%%%'%)'$%%$E&&$'%'&$%)(+E$$'($($%$&&&$'$&$'$&$'$&%&'&'$'$/&&%)%%&%%$&$'D$(%$&$'%%E$()&&$$'(D&%(D%&($(&+%'$($(&+%%$&&($&$$'$F%'%'%'$&'$%0+&&%$%&$&&&$'&&'&%'$&'&'&&)%+$)&,$'%'%($%%')'*'%'*(&(&'&%$%%%$F$F$F$&$&&'&&$'&&'(%&'&'&%'$&'&&)%+$)&,$'%'%($$'%''$(%%'D'#)%$$&$(%'%$$&$($E$(('&%(&($%,(&&&%&&&E&$'E&($)%($%%$&%$&&&&&D'&%%$($'%)+'+'/%+$+(0%&&&$&(&'&%&'%)$F&$%&%'$'%1*-#'$&D(%%$'&&D'%$$'%'%&$(%DD($''$%&$()%&&%&$'E$$'%E$)%,%.,(%&%%'$'&%+$()%&&%&%&$F$'%'%%'$$'E%$)#'$&'$$'$(%+&(&*&&'$'(&$'%&('K/D(J/D&('..($%$'$%&&&%%'%'&$$E$'$G'D$F$'$'$F%G(D&F(D$)#($(&%($%'$E$F$$$$%'$F#'%&%%$'$E$'%&$$$'%&$&$&$'%E&&%'$'%&$F%'$(%&$&$(C)&$$'%$D%$E$&$F$F$&E%#)$(%$$&$(%%$E$&$)$F$F$%%%0@0000H8H40H000047P00P@001000@0B0HP@:H9T8P000LB8d@800@I0<110000QQ8400P10030005940@410020000Q02000@0200000@P0101@8000440400000000808000000000@00000000P`0000000040400@0004<000000000008000030000000000P020T400020@0@00000000000000000000000000P0000000400400000400220080000100000000000000000P000000000000P000000@00402000000000@00000000000000000000040000000000000", "Æ&ÁĂÂА𝔄ÀΑĀ⩓Ą𝔸⁡Å𝒜≔ÃÄ∖⫧⌆Б∵ℬΒ𝔅𝔹˘ℬ≎Ч©Ć⋒ⅅℭČÇĈ∰Ċ¸·ℭΧ⊙⊖⊕⊗∲”’∷⩴≡∯∮ℂ∐∳⨯𝒞⋓≍ⅅ⤑ЂЅЏ‡↡⫤ĎД∇Δ𝔇´˙˝`˜⋄ⅆ𝔻¨⃜≐∯¨⇓⇐⇔⫤⟸⟺⟹⇒⊨⇑⇕∥↓⤓⇵̑⥐⥞↽⥖⥟⇁⥗⊤↧⇓𝒟ĐŊÐÉĚÊЭĖ𝔈È∈Ē◻▫Ę𝔼Ε⩵≂⇌ℰ⩳ΗË∃ⅇФ𝔉◼▪𝔽∀ℱℱЃ>ΓϜĞĢĜГĠ𝔊⋙𝔾≥⋛≧⪢≷⩾≳𝒢≫Ъˇ^Ĥℌℋℍ─ℋĦ≎≏ЕIJЁÍÎИİℑÌℑĪⅈ⇒∬∫⋂⁣⁢Į𝕀ΙℐĨІÏĴЙ𝔍𝕁𝒥ЈЄХЌΚĶК𝔎𝕂𝒦Љ<ĹΛ⟪ℒ↞ĽĻЛ⟨←⇤⇆⌈⟦⥡⇃⥙⌊↔⥎⊣↤⥚⊲⧏⊴⥑⥠↿⥘↼⥒⇐⇔⋚≦≶⪡⩽≲𝔏⋘⇚Ŀ⟵⟷⟶⟸⟺⟹𝕃↙↘ℒ↰Ł≪⤅М ℳ𝔐∓𝕄ℳΜЊŃŇŅН​​​​≫≪\n𝔑⁠\xA0ℕ⫬≢≭∦∉≠≂̸∄≯≱≧̸≫̸≹⩾̸≵≎̸≏̸⋪⧏̸⋬≮≰≸≪̸⩽̸≴⪢̸⪡̸⊀⪯̸⋠∌⋫⧐̸⋭⊏̸⋢⊐̸⋣⊂⃒⊈⊁⪰̸⋡≿̸⊃⃒⊉≁≄≇≉∤𝒩ÑΝŒÓÔОŐ𝔒ÒŌΩΟ𝕆“‘⩔𝒪ØÕ⨷Ö‾⏞⎴⏜∂П𝔓ΦΠ±ℌℙ⪻≺⪯≼≾″∏∷∝𝒫Ψ\"𝔔ℚ𝒬⤐®Ŕ⟫↠⤖ŘŖРℜ∋⇋⥯ℜΡ⟩→⇥⇄⌉⟧⥝⇂⥕⌋⊢↦⥛⊳⧐⊵⥏⥜↾⥔⇀⥓⇒ℝ⥰⇛ℛ↱⧴ЩШЬŚ⪼ŠŞŜС𝔖↓←→↑Σ∘𝕊√□⊓⊏⊑⊐⊒⊔𝒮⋆⋐⋐⊆≻⪰≽≿∋∑⋑⊃⊇⋑Þ™ЋЦ ΤŤŢТ𝔗∴Θ   ∼≃≅≈𝕋⃛𝒯ŦÚ↟⥉ЎŬÛУŰ𝔘ÙŪ_⏟⎵⏝⋃⊎Ų𝕌↑⤒⇅↕⥮⊥↥⇑⇕↖↗ϒΥŮ𝒰ŨÜ⊫⫫В⊩⫦⋁‖‖∣|❘≀ 𝔙𝕍𝒱⊪Ŵ⋀𝔚𝕎𝒲𝔛Ξ𝕏𝒳ЯЇЮÝŶЫ𝔜𝕐𝒴ŸЖŹŽЗŻ​Ζℨℤ𝒵áă∾∾̳∿â´аæ⁡𝔞àℵℵαā⨿&∧⩕⩜⩘⩚∠⦤∠∡⦨⦩⦪⦫⦬⦭⦮⦯∟⊾⦝∢Å⍼ą𝕒≈⩰⩯≊≋'≈≊å𝒶*≈≍ãä∳⨑⫭≌϶‵∽⋍⊽⌅⌅⎵⎶≌б„∵∵⦰϶ℬβℶ≬𝔟⋂◯⋃⨀⨁⨂⨆★▽△⨄⋁⋀⤍⧫▪▴▾◂▸␣▒░▓█=⃥≡⃥⌐𝕓⊥⊥⋈╗╔╖╓═╦╩╤╧╝╚╜╙║╬╣╠╫╢╟⧉╕╒┐┌─╥╨┬┴⊟⊞⊠╛╘┘└│╪╡╞┼┤├‵˘¦𝒷⁏∽⋍\\⧅⟈••≎⪮≏≏ć∩⩄⩉⩋⩇⩀∩︀⁁ˇ⩍čçĉ⩌⩐ċ¸⦲¢·𝔠ч✓✓χ○⧃ˆ≗↺↻®Ⓢ⊛⊚⊝≗⨐⫯⧂♣♣:≔≔,@∁∘∁ℂ≅⩭∮𝕔∐©℗↵✗𝒸⫏⫑⫐⫒⋯⤸⤵⋞⋟↶⤽∪⩈⩆⩊⊍⩅∪︀↷⤼⋞⋟⋎⋏¤↶↷⋎⋏∲∱⌭⇓⥥†ℸ↓‐⊣⤏˝ďдⅆ‡⇊⩷°δ⦱⥿𝔡⇃⇂⋄⋄♦♦¨ϝ⋲÷÷⋇⋇ђ⌞⌍$𝕕˙≐≑∸∔⊡⌆↓⇊⇃⇂⤐⌟⌌𝒹ѕ⧶đ⋱▿▾⇵⥯⦦џ⟿⩷≑é⩮ě≖ê≕эėⅇ≒𝔢⪚è⪖⪘⪙⏧ℓ⪕⪗ē∅∅∅   ŋ ę𝕖⋕⧣⩱εεϵ≖≕≂⪖⪕=≟≡⩸⧥≓⥱ℯ≐≂ηðë€!∃ℰⅇ≒ф♀ffiffffl𝔣fifj♭fl▱ƒ𝕗∀⋔⫙⨍½⅓¼⅕⅙⅛⅔⅖¾⅗⅜⅘⅚⅝⅞⁄⌢𝒻≧⪌ǵγϝ⪆ğĝгġ≥⋛≥≧⩾⩾⪩⪀⪂⪄⋛︀⪔𝔤≫⋙ℷѓ≷⪒⪥⪤≩⪊⪊⪈⪈≩⋧𝕘`ℊ≳⪎⪐>⪧⩺⋗⦕⩼⪆⥸⋗⋛⪌≷≳≩︀≩︀⇔ ½ℋъ↔⥈↭ℏĥ♥♥…⊹𝔥⤥⤦⇿∻↩↪𝕙―𝒽ℏħ⁃‐í⁣îие¡⇔𝔦ìⅈ⨌∭⧜℩ijīℑℐℑı⊷Ƶ∈℅∞⧝ı∫⊺ℤ⊺⨗⨼ёį𝕚ι⨼¿𝒾∈⋹⋵⋴⋳∈⁢ĩіïĵй𝔧ȷ𝕛𝒿јєκϰķк𝔨ĸхќ𝕜𝓀⇚⇐⤛⤎≦⪋⥢ĺ⦴ℒλ⟨⦑⟨⪅«←⇤⤟⤝↩↫⤹⥳↢⪫⤙⪭⪭︀⤌❲{[⦋⦏⦍ľļ⌈{л⤶“„⥧⥋↲≤←↢↽↼⇇↔⇆⇋↭⋋⋚≤≦⩽⩽⪨⩿⪁⪃⋚︀⪓⪅⋖⋚⪋≶≲⥼⌊𝔩≶⪑↽↼⥪▄љ≪⇇⌞⥫◺ŀ⎰⎰≨⪉⪉⪇⪇≨⋦⟬⇽⟦⟵⟷⟼⟶↫↬⦅𝕝⨭⨴∗_◊◊⧫(⦓⇆⌟⇋⥭‎⊿‹𝓁↰≲⪍⪏[‘‚ł<⪦⩹⋖⋋⋉⥶⩻⦖◃⊴◂⥊⥦≨︀≨︀∺¯♂✠✠↦↦↧↤↥▮⨩м—∡𝔪℧µ∣*⫰·−⊟∸⨪⫛…∓⊧𝕞∓𝓂∾μ⊸⊸⋙̸≫⃒≫̸⇍⇎⋘̸≪⃒≪̸⇏⊯⊮∇ń∠⃒≉⩰̸≋̸ʼn≉♮♮ℕ\xA0≎̸≏̸⩃ňņ≇⩭̸⩂н–≠⇗⤤↗↗≐̸≢⤨≂̸∄∄𝔫≧̸≱≱≧̸⩾̸⩾̸≵≯≯⇎↮⫲∋⋼⋺∋њ⇍≦̸↚‥≰↚↮≰≦̸⩽̸⩽̸≮≴≮⋪⋬∤𝕟¬∉⋹̸⋵̸∉⋷⋶∌∌⋾⋽∦∦⫽⃥∂̸⨔⊀⋠⪯̸⊀⪯̸⇏↛⤳̸↝̸↛⋫⋭⊁⋡⪰̸𝓃∤∦≁≄≄∤∦⋢⋣⊄⫅̸⊈⊂⃒⊈⫅̸⊁⪰̸⊅⫆̸⊉⊃⃒⊉⫆̸≹ñ≸⋪⋬⋫⋭ν#№ ⊭⤄≍⃒⊬≥⃒>⃒⧞⤂≤⃒<⃒⊴⃒⤃⊵⃒∼⃒⇖⤣↖↖⤧Ⓢó⊛⊚ôо⊝ő⨸⊙⦼œ⦿𝔬˛ò⧁⦵Ω∮↺⦾⦻‾⧀ōωο⦶⊖𝕠⦷⦹⊕∨↻⩝ℴℴªº⊶⩖⩗⩛ℴø⊘õ⊗⨶ö⌽∥¶∥⫳⫽∂п%.‰⊥‱𝔭φϕℳ☎π⋔ϖℏℎℏ+⨣⊞⨢∔⨥⩲±⨦⨧±⨕𝕡£≺⪳⪷≼⪯≺⪷≼⪯⪹⪵⋨≾′ℙ⪵⪹⋨∏⌮⌒⌓∝∝≾⊰𝓅ψ 𝔮⨌𝕢⁗𝓆ℍ⨖?≟\"⇛⇒⤜⤏⥤∽̱ŕ√⦳⟩⦒⦥⟩»→⥵⇥⤠⤳⤞↪↬⥅⥴↣↝⤚∶ℚ⤍❳}]⦌⦎⦐řŗ⌉}р⤷⥩””↳ℜℛℜℝ▭®⥽⌋𝔯⇁⇀⥬ρϱ→↣⇁⇀⇄⇌⇉↝⋌˚≓⇄⇌‏⎱⎱⫮⟭⇾⟧⦆𝕣⨮⨵)⦔⨒⇉›𝓇↱]’’⋌⋊▹⊵▸⧎⥨℞ś‚≻⪴⪸š≽⪰şŝ⪶⪺⋩⨓≿с⋅⊡⩦⇘⤥↘↘§;⤩∖∖✶𝔰⌢♯щш∣∥­σςς∼⩪≃≃⪞⪠⪝⪟≆⨤⥲←∖⨳⧤∣⌣⪪⪬⪬︀ь/⧄⌿𝕤♠♠∥⊓⊓︀⊔⊔︀⊏⊑⊏⊑⊐⊒⊐⊒□□▪▪→𝓈∖⌣⋆☆★ϵϕ¯⊂⫅⪽⊆⫃⫁⫋⊊⪿⥹⊂⊆⫅⊊⫋⫇⫕⫓≻⪸≽⪰⪺⪶⋩≿∑♪⊃¹²³⫆⪾⫘⊇⫄⟉⫗⥻⫂⫌⊋⫀⊃⊇⫆⊋⫌⫈⫔⫖⇙⤦↙↙⤪ß⌖τ⎴ťţт⃛⌕𝔱∴∴θϑϑ≈∼ ≈∼þ˜×⊠⨱⨰∭⤨⊤⌶⫱𝕥⫚⤩‴™▵▿◃⊴≜▹⊵◬≜⨺⨹⧍⨻⏢𝓉цћŧ≬↞↠⇑⥣ú↑ўŭûу⇅ű⥮⥾𝔲ù↿↾▀⌜⌜⌏◸ū¨ų𝕦↑↕↿↾⊎υϒυ⇈⌝⌝⌎ů◹𝓊⋰ũ▵▴⇈ü⦧⇕⫨⫩⊨⦜ϵϰ∅ϕϖ∝↕ϱς⊊︀⫋︀⊋︀⫌︀ϑ⊲⊳в⊢∨⊻≚⋮||𝔳⊲⊂⃒⊃⃒𝕧∝⊳𝓋⫋︀⊊︀⫌︀⊋︀⦚ŵ⩟∧≙℘𝔴𝕨℘≀≀𝓌⋂◯⋃▽𝔵⟺⟷ξ⟸⟵⟼⋻⨀𝕩⨁⨂⟹⟶𝓍⨆⨄△⋁⋀ýяŷы¥𝔶ї𝕪𝓎юÿźžзżℨζ𝔷ж⇝𝕫𝓏‍‌"]; /** Multiplier deriving the first candidate bucket from a key. */ const BUCKET_HASH_1 = 2654435761; /** Multiplier deriving the second candidate bucket from a key. */ const BUCKET_HASH_2 = 2246822507; /** Size of the (c0,c1) class table (10-bit index). */ const PAIR_TABLE_SIZE = 1024; /** * Map an alphanumeric char code to 6 bits (1..62); 0 = not alphanumeric. * Used for the key's last-character field. */ const CHAR_REMAP = (() => { const remap = /* @__PURE__ */ new Uint8Array(128); for (let code = 48; code <= 57; code++) remap[code] = code - 47; for (let code = 65; code <= 90; code++) remap[code] = code - 54; for (let code = 97; code <= 122; code++) remap[code] = code - 60; return remap; })(); /** * The exact 32-bit key for a name occurring at `nameStart` with `length` * chars. Covers the first two and last two characters plus the length; * middle characters are verified separately against the names blob. * * The hot decoder inlines this computation; tests assert both stay in sync * by looking every entity up through the public API. * @param text Text containing the name. * @param nameStart Index of the name's first character. * @param length Length of the name. */ function exactKey(text, nameStart, length) { return text.charCodeAt(nameStart) << 25 | text.charCodeAt(nameStart + 1) << 18 | text.charCodeAt(nameStart + length - 2) << 11 | CHAR_REMAP[text.charCodeAt(nameStart + length - 1)] << 5 | length; } /** * The 10-bit (c0,c1) class index used by the probe front end. The function * was chosen by exhaustive search over load-free mixers for minimal * candidate-set collisions on the real entity set. * @param c0 First char code of the candidate name. * @param c1 Second char code. */ function pairIndex(c0, c1) { return (c0 * 3 << 3 ^ c1) & 1023; } /** * First candidate bucket for a key in a table of `buckets` buckets. * @param key Exact key. * @param buckets Bucket count. */ function bucketOne(key, buckets) { return (Math.imul(key, BUCKET_HASH_1) >>> 16) * buckets >>> 16; } /** * Second candidate bucket for a key. * @param key Exact key. * @param buckets Bucket count. */ function bucketTwo(key, buckets) { return (Math.imul(key, BUCKET_HASH_2) >>> 16) * buckets >>> 16; } /** * Build the lookup structures from a serialized dataset. * @param packed Serialized decode data, see `decode-data-format.ts`. */ function initDecodeData(packed) { const [data, values] = packed; const nameCount = data.charCodeAt(0) - 48 << 6 | data.charCodeAt(1) - 48; const suffixesLength = data.charCodeAt(2) - 48 << 6 | data.charCodeAt(3) - 48; const buckets = data.charCodeAt(4) - 48 << 6 | data.charCodeAt(5) - 48; const metaStart = 6 + suffixesLength; const choicesStart = metaStart + 2 * nameCount; const slotCount = 2 * buckets; const keys = new Int32Array(slotCount); const slotMidOff = new Uint16Array(slotCount); const slotValue = new Uint16Array(slotCount); const lengthBits = new Uint32Array(PAIR_TABLE_SIZE); const middleOffsets = /* @__PURE__ */ new Map(); const middles = []; let name = ""; let suffixOffset = 6; let valueOffset = 0; for (let index = 0; index < nameCount; index++) { const meta0 = data.charCodeAt(metaStart + 2 * index) - 35; const meta1 = data.charCodeAt(metaStart + 2 * index + 1) - 35; const prefixLength = meta0 & 31; const length = prefixLength + (meta1 & 31); const valueLength = (meta1 >> 5) + 1; name = name.slice(0, prefixLength) + data.slice(suffixOffset, suffixOffset + length - prefixLength); suffixOffset += length - prefixLength; const key = exactKey(name, 0, length); let slot = 2 * ((data.charCodeAt(choicesStart + Math.floor(index / 6)) - 48 & 1 << index % 6) === 0 ? bucketOne : bucketTwo)(key, buckets); if (keys[slot] !== 0) slot += 1; keys[slot] = key; if (length > 4) { const middle = name.slice(2, length - 2); const existing = middleOffsets.get(middle); if (existing === void 0) { middleOffsets.set(middle, middles.length); slotMidOff[slot] = middles.length; for (let middleIndex = 0; middleIndex < middle.length; middleIndex += 2) middles.push(middle.charCodeAt(middleIndex) | middle.charCodeAt(middleIndex + 1) << 16); } else slotMidOff[slot] = existing; } const pair = pairIndex(name.charCodeAt(0), name.charCodeAt(1)); lengthBits[pair] |= length <= 16 ? 1 << length - 2 : 32768; if ((meta0 & 32) !== 0) lengthBits[pair] |= 1 << length - 2 + 16; slotValue[slot] = valueOffset << 2 | valueLength - 1 | (meta0 & 32) >> 4; valueOffset += valueLength; } return { keys, buckets, slotMidOff, slotValue, values, lengthBits, middles: new Uint32Array(middles) }; } // ../../node_modules/.pnpm/entities@9.0.0/node_modules/entities/dist/decode.js const CHAR_NUM = 35; const CHAR_SEMI = 59; const CHAR_EQUALS = 61; const CHAR_ZERO = 48; const CHAR_LOWER_A = 97; const CHAR_LOWER_X = 120; const CHAR_UPPER_A = 65; /** Bit that needs to be set to convert an upper case ASCII character to lower case */ const TO_LOWER_BIT = 32; /** * Unsigned subtraction trick: (code - lo) >>> 0 wraps negatives to large * values, so a single `<=` covers the entire [lo..hi] range check. * @param code Code point to check. */ function isNumber(code) { return code - CHAR_ZERO >>> 0 <= 9; } function isAlphaNumeric(code) { return isNumber(code) || (code | TO_LOWER_BIT) - CHAR_LOWER_A >>> 0 <= 25; } /** * Checks if the given character is a valid end character for an entity in an attribute. * * Attribute values that aren't terminated properly aren't parsed, and shouldn't lead to a parser error. * See the example in https://html.spec.whatwg.org/multipage/parsing.html#named-character-reference-state * @param code Code point to check. */ function isEntityInAttributeInvalidEnd(code) { return code === CHAR_EQUALS || isAlphaNumeric(code); } /** * Decoding mode for named entities. */ var DecodingMode; (function(DecodingMode) { /** Entities in text nodes that can end with any character. */ DecodingMode[DecodingMode["Legacy"] = 0] = "Legacy"; /** Only allow entities terminated with a semicolon. */ DecodingMode[DecodingMode["Strict"] = 1] = "Strict"; /** Entities in attributes have limitations on ending characters. */ DecodingMode[DecodingMode["Attribute"] = 2] = "Attribute"; })(DecodingMode || (DecodingMode = {})); /** Decode data for HTML entities. */ const htmlDecode = /* #__PURE__ */ initDecodeData(htmlDecodeData); const htmlKeys = /* #__PURE__ */ (() => htmlDecode.keys)(); const htmlBuckets = /* #__PURE__ */ (() => htmlDecode.buckets)(); const htmlSlotMidOff = /* #__PURE__ */ (() => htmlDecode.slotMidOff)(); const htmlLengthBits = /* #__PURE__ */ (() => htmlDecode.lengthBits)(); const htmlMiddles = /* #__PURE__ */ (() => htmlDecode.middles)(); /** Hoisted for the specialized HTML cores; see `emitHtmlValue`. */ const htmlSlotValue = /* #__PURE__ */ (() => htmlDecode.slotValue)(); const htmlValues = /* #__PURE__ */ (() => htmlDecode.values)(); /** * Find the slot matching `text[start..start+length)`, or -1. A match proves * every character of the span (exact key + middle comparison). * @param text Input text. * @param start Start of the span in `text`. * @param length Length of the span. */ function findSlotHtml(text, start, length) { const c0 = text.charCodeAt(start); const c1 = text.charCodeAt(start + 1); const c2 = text.charCodeAt(start + length - 2); const c3 = text.charCodeAt(start + length - 1); if ((c0 | c1 | c2 | c3) > 127) return -1; const key = c0 << 25 | c1 << 18 | c2 << 11 | CHAR_REMAP[c3] << 5 | length; let slot = 2 * ((Math.imul(key, BUCKET_HASH_1) >>> 16) * htmlBuckets >>> 16); for (let attempt = 0;; attempt++) { if (htmlKeys[slot] === key && (length <= 4 || isMidMatchHtml(slot, text, start, length))) return slot; if (htmlKeys[slot + 1] === key && (length <= 4 || isMidMatchHtml(slot + 1, text, start, length))) return slot + 1; if (attempt === 1) return -1; slot = 2 * ((Math.imul(key, BUCKET_HASH_2) >>> 16) * htmlBuckets >>> 16); } } /** * Compare the middle characters (positions 2..length-3) of the candidate at * `slot` against the input. The key already proves the outer characters and * the length. Names of length at most four are accepted by the caller. * @param slot Slot of the candidate. * @param text Input text. * @param start Start of the span in `text`. * @param length Length of the span. */ function isMidMatchHtml(slot, text, start, length) { let wordIndex = htmlSlotMidOff[slot]; let index = start + 2; const end = start + length - 2; while (index + 1 < end) { if ((text.charCodeAt(index) | text.charCodeAt(index + 1) << 16) !== htmlMiddles[wordIndex++]) return false; index += 2; } return index === end || text.charCodeAt(index) === (htmlMiddles[wordIndex] & 65535); } /** ASCII digit values; 0xff marks characters outside the hexadecimal range. */ const numericDigits = /* #__PURE__ */ (() => { const digits = (/* @__PURE__ */ new Uint8Array(128)).fill(255); for (let digit = 0; digit < 10; digit++) digits[CHAR_ZERO + digit] = digit; for (let digit = 0; digit < 6; digit++) { digits[CHAR_UPPER_A + digit] = digit + 10; digits[CHAR_LOWER_A + digit] = digit + 10; } return digits; })(); /** * Find the longest legacy (semicolon-less) match for the name starting at * `start`, using the per-class legacy length bits. Returns * `slot << 3 | matchLength`, or -1 if there is no match. Only called after * the exact probes failed (the miss path). * @param input Input text. * @param start Start of the name. * @param maxLength Number of available run characters. */ function findLegacySlot(input, start, maxLength) { let legacy = htmlLengthBits[pairIndex(input.charCodeAt(start), input.charCodeAt(start + 1))] >>> 16 & 31; while (legacy !== 0) { const top = 31 - Math.clz32(legacy); legacy ^= 1 << top; if (top + 2 > maxLength) continue; const slot = findSlotHtml(input, start, top + 2); if (slot >= 0 && (htmlSlotValue[slot] & 2) !== 0) return slot << 3 | top + 2; } return -1; } /** * Match a class containing long names without probing all its shorter lengths. * The 32-character window bounds the scan even for invalid or unterminated runs. * Returns `(slot << 6) | consumed`, excluding the `&`, or -1 on a miss. * @param input Input containing the candidate name. * @param start Start of the name. * @param mode Decoding mode, including the rules for legacy matches. */ function findLongClassMatch(input, start, mode) { const length = input.slice(start, start + 32).indexOf(";"); if (length - 2 >>> 0 <= 29) { const slot = findSlotHtml(input, start, length); if (slot >= 0) return slot << 6 | length + 1; } if (mode !== DecodingMode.Strict) { const packed = findLegacySlot(input, start, Math.min(31, input.length - start)); if (packed >= 0) { const length = packed & 7; if (mode !== DecodingMode.Attribute || start + length >= input.length || !isEntityInAttributeInvalidEnd(input.charCodeAt(start + length))) return packed >> 3 << 6 | length; } } return -1; } const STATE_ENTITY_START = 0; const STATE_NUMERIC_START = 1; const STATE_NUMERIC_DECIMAL = 2; const STATE_NUMERIC_HEX = 3; const STATE_NAMED_ENTITY = 4; /** * Token decoder with support of writing partial entities; the shared base * of `HtmlEntityDecoder` and `XmlEntityDecoder`. Numeric entities are * identical in both document types and are handled here; named entities are * left to the subclasses. * * The decoder is driven by a tokenizer: after a `&`, write the following * input (possibly in chunks). `write` returns the number of characters * consumed once the entity is decided, or -1 while more input is needed. * Rejection may surface later than strictly possible (the decoder buffers * until a terminator or the name-length limit), but emitted code points, * consumed counts, and final return values are exact. */ var EntityDecoderBase = class { emitCodePoint; errors; /** The current state of the decoder. */ state = STATE_ENTITY_START; /** Characters that were consumed while parsing an entity. */ consumed = 1; /** Accumulated numeric code point, or a packed partial XML name. */ result = 0; /** The mode in which the decoder is operating. */ decodeMode = DecodingMode.Strict; /** Replacement rules for numeric character references. */ replaceNumericCodePoint = replaceCodePoint; constructor(emitCodePoint, errors) { this.emitCodePoint = emitCodePoint; this.errors = errors; } /** * Switches between the numeric decimal and hexadecimal states. * * Equivalent to the `Numeric character reference state` in the HTML spec. * @param input The string containing the entity (or a continuation of the entity). * @param offset The current offset. * @returns The number of characters that were consumed, or -1 if the entity is incomplete. */ stateNumericStart(input, offset) { if (offset >= input.length) return -1; if ((input.charCodeAt(offset) | TO_LOWER_BIT) === CHAR_LOWER_X) { this.state = STATE_NUMERIC_HEX; this.consumed += 1; return this.stateNumericHex(input, offset + 1); } this.state = STATE_NUMERIC_DECIMAL; return this.stateNumericDecimal(input, offset); } /** * Parses a hexadecimal numeric entity. * * Equivalent to the `Hexadecimal character reference state` in the HTML spec. * @param input The string containing the entity (or a continuation of the entity). * @param offset The current offset. * @returns The number of characters that were consumed, or -1 if the entity is incomplete. */ stateNumericHex(input, offset) { const inputLength = input.length; let { result, consumed } = this; let index = offset; while (index < inputLength) { const char = input.charCodeAt(index); const digit = numericDigits[char]; if (digit <= 15) result = result * 16 + digit; else { this.result = result; this.consumed = consumed; return this.emitNumericEntity(char, 3); } consumed += 1; index += 1; } this.result = result; this.consumed = consumed; return -1; } /** * Parses a decimal numeric entity. * * Equivalent to the `Decimal character reference state` in the HTML spec. * @param input The string containing the entity (or a continuation of the entity). * @param offset The current offset. * @returns The number of characters that were consumed, or -1 if the entity is incomplete. */ stateNumericDecimal(input, offset) { const inputLength = input.length; let { result, consumed } = this; let index = offset; while (index < inputLength) { const digit = input.charCodeAt(index) - CHAR_ZERO; if (digit >>> 0 > 9) { this.result = result; this.consumed = consumed; return this.emitNumericEntity(digit + CHAR_ZERO, 2); } result = result * 10 + digit; consumed += 1; index += 1; } this.result = result; this.consumed = consumed; return -1; } /** * Validate and emit a numeric entity. * * Implements the logic from the `Hexadecimal character reference start * state` and `Numeric character reference end state` in the HTML spec. * @param lastCp The last code point of the entity. Used to see if the * entity was terminated with a semicolon. * @param expectedLength The minimum number of characters that should be * consumed. Used to validate that at least one digit * was consumed. * @returns The number of characters that were consumed. */ emitNumericEntity(lastCp, expectedLength) { if (this.consumed <= expectedLength) { this.errors?.absenceOfDigitsInNumericCharacterReference(this.consumed); return 0; } if (lastCp === CHAR_SEMI) this.consumed += 1; else if (this.decodeMode === DecodingMode.Strict) return 0; this.emitCodePoint(this.replaceNumericCodePoint(this.result), this.consumed); if (this.errors) { if (lastCp !== CHAR_SEMI) this.errors.missingSemicolonAfterCharacterReference(); this.errors.validateNumericCharacterReference(this.result); } return this.consumed; } /** * Resets the instance to make it reusable. * @param decodeMode Entity decoding mode to use. */ startEntity(decodeMode) { this.decodeMode = decodeMode; this.state = STATE_ENTITY_START; this.result = 0; this.consumed = 1; } /** * Write an entity to the decoder. This can be called multiple times with partial entities. * If the entity is incomplete, the decoder will return -1. * @param input The string containing the entity (or a continuation of the entity). * @param offset The offset at which the entity begins. Should be 0 if this is not the first call. * @returns The number of characters that were consumed, or -1 if the entity is incomplete. */ write(input, offset) { switch (this.state) { case STATE_ENTITY_START: if (input.charCodeAt(offset) === CHAR_NUM) { this.state = STATE_NUMERIC_START; this.consumed += 1; return this.stateNumericStart(input, offset + 1); } this.state = STATE_NAMED_ENTITY; return this.stateNamedEntity(input, offset); case STATE_NUMERIC_START: return this.stateNumericStart(input, offset); case STATE_NUMERIC_DECIMAL: return this.stateNumericDecimal(input, offset); case STATE_NUMERIC_HEX: return this.stateNumericHex(input, offset); default: return this.stateNamedEntity(input, offset); } } /** * Signal to the parser that the end of the input was reached. * * Remaining data will be emitted and relevant errors will be produced. * @returns The number of characters consumed. */ end() { switch (this.state) { case STATE_NAMED_ENTITY: return this.endNamedEntity(); case STATE_NUMERIC_DECIMAL: return this.emitNumericEntity(0, 2); case STATE_NUMERIC_HEX: return this.emitNumericEntity(0, 3); case STATE_NUMERIC_START: this.errors?.absenceOfDigitsInNumericCharacterReference(this.consumed); return 0; default: return 0; } } }; /** * Streaming decoder for HTML entities. * * When the entity fits inside the current chunk (the common case), the * lookup runs directly on the chunk via the same length-probe scheme as the * synchronous decoder; chunk-boundary runs use a reusable character buffer. */ var HtmlEntityDecoder = class extends EntityDecoderBase { /** Total name characters seen for the current named entity. */ runLength = 0; /** Reused for ASCII alphanumerics; the 32nd character rules out an exact match. */ nameBuffer = /* @__PURE__ */ new Uint8Array(32); /** * Emit the replacement for a matched slot. Values are at most two * UTF-16 code units; like previous versions, each unit is emitted as * its own callback (surrogate halves included). * @param slot The matched slot. */ emitSlot(slot) { const packed = htmlSlotValue[slot]; const off = packed >> 2; this.emitCodePoint(htmlValues.charCodeAt(off), this.consumed); if ((packed & 1) !== 0) this.emitCodePoint(htmlValues.charCodeAt(off + 1), this.consumed); } startEntity(decodeMode) { super.startEntity(decodeMode); this.runLength = 0; } stateNamedEntity(input, offset) { const inputLength = input.length; if (this.runLength === 0 && offset + 17 <= inputLength) { const pair = pairIndex(input.charCodeAt(offset), input.charCodeAt(offset + 1)); const bits = htmlLengthBits[pair]; if ((bits & 32768) !== 0 && offset + 32 <= inputLength) { const packed = findLongClassMatch(input, offset, this.decodeMode); if (packed >= 0) { const length = packed & 63; this.consumed = length + 1; this.emitSlot(packed >> 6); if (input.charCodeAt(offset + length - 1) !== CHAR_SEMI) this.errors?.missingSemicolonAfterCharacterReference(); return this.consumed; } return 0; } let probed = bits & 32767; while (probed !== 0) { const low = probed & -probed; probed ^= low; const length = 33 - Math.clz32(low); if (input.charCodeAt(offset + length) === CHAR_SEMI) { const slot = findSlotHtml(input, offset, length); if (slot >= 0) { this.consumed = length + 2; this.emitSlot(slot); return this.consumed; } } } if ((bits & 32768) === 0) { if (this.decodeMode !== DecodingMode.Strict) { const packed = findLegacySlot(input, offset, 31); if (packed >= 0) { const matchLength = packed & 7; const next = input.charCodeAt(offset + matchLength); if (this.decodeMode === DecodingMode.Attribute && isEntityInAttributeInvalidEnd(next)) return 0; this.consumed = matchLength + 1; this.emitSlot(packed >> 3); this.errors?.missingSemicolonAfterCharacterReference(); return this.consumed; } } return 0; } } let index = offset; let { runLength } = this; let terminator = -1; const scanEnd = Math.min(inputLength, offset + 32 - runLength); while (index < scanEnd) { const char = input.charCodeAt(index); if (!isAlphaNumeric(char)) { terminator = char; break; } this.nameBuffer[runLength++] = char; index++; } if (terminator < 0 && runLength < 32) { this.runLength = runLength; return -1; } if (terminator === CHAR_SEMI && runLength - 2 >>> 0 <= 29) { const slot = findBufferedHtmlSlot(this.nameBuffer, runLength); if (slot >= 0) { this.consumed = runLength + 2; this.emitSlot(slot); return this.consumed; } } if (this.decodeMode !== DecodingMode.Strict && runLength >= 2) { const packed = findBufferedLegacySlot(this.nameBuffer, runLength); if (packed >= 0) { const length = packed & 7; const next = length < runLength ? this.nameBuffer[length] : terminator; if (this.decodeMode === DecodingMode.Attribute && isEntityInAttributeInvalidEnd(next)) return 0; this.consumed = length + 1; this.emitSlot(packed >> 3); this.errors?.missingSemicolonAfterCharacterReference(); return this.consumed; } } return 0; } endNamedEntity() { if (this.decodeMode === DecodingMode.Strict || this.runLength < 2) return 0; const packed = findBufferedLegacySlot(this.nameBuffer, this.runLength); if (packed < 0) return 0; if (this.decodeMode === DecodingMode.Attribute && (packed & 7) < this.runLength) return 0; this.consumed = (packed & 7) + 1; this.emitSlot(packed >> 3); this.errors?.missingSemicolonAfterCharacterReference(); return this.consumed; } }; /** * Find a buffered name. Its characters were already checked as ASCII * alphanumerics while scanning, so no outer-character range check is needed. * @param buffer Reusable character buffer. * @param length Number of characters to match. */ function findBufferedHtmlSlot(buffer, length) { const key = buffer[0] << 25 | buffer[1] << 18 | buffer[length - 2] << 11 | CHAR_REMAP[buffer[length - 1]] << 5 | length; let slot = 2 * ((Math.imul(key, BUCKET_HASH_1) >>> 16) * htmlBuckets >>> 16); for (let attempt = 0;; attempt++) { if (htmlKeys[slot] === key && (length <= 4 || isBufferedMiddle(slot, buffer, length))) return slot; if (htmlKeys[slot + 1] === key && (length <= 4 || isBufferedMiddle(slot + 1, buffer, length))) return slot + 1; if (attempt === 1) return -1; slot = 2 * ((Math.imul(key, BUCKET_HASH_2) >>> 16) * htmlBuckets >>> 16); } } function isBufferedMiddle(slot, buffer, length) { let wordIndex = htmlSlotMidOff[slot]; let index = 2; const end = length - 2; while (index + 1 < end) { if ((buffer[index] | buffer[index + 1] << 16) !== htmlMiddles[wordIndex++]) return false; index += 2; } return index === end || buffer[index] === (htmlMiddles[wordIndex] & 65535); } /** * Find the longest legacy name in the buffer, packed as `(slot << 3) | length`. * @param buffer Reusable character buffer. * @param length Number of buffered characters. */ function findBufferedLegacySlot(buffer, length) { let legacy = htmlLengthBits[pairIndex(buffer[0], buffer[1])] >>> 16 & 31; while (legacy !== 0) { const top = 31 - Math.clz32(legacy); legacy ^= 1 << top; if (top + 2 > length) continue; const slot = findBufferedHtmlSlot(buffer, top + 2); if (slot >= 0 && (htmlSlotValue[slot] & 2) !== 0) return slot << 3 | top + 2; } return -1; } // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/common/html.js /** All valid namespaces in HTML. */ var NS; (function(NS) { NS["HTML"] = "http://www.w3.org/1999/xhtml"; NS["MATHML"] = "http://www.w3.org/1998/Math/MathML"; NS["SVG"] = "http://www.w3.org/2000/svg"; NS["XLINK"] = "http://www.w3.org/1999/xlink"; NS["XML"] = "http://www.w3.org/XML/1998/namespace"; NS["XMLNS"] = "http://www.w3.org/2000/xmlns/"; })(NS || (NS = {})); var ATTRS; (function(ATTRS) { ATTRS["TYPE"] = "type"; ATTRS["ACTION"] = "action"; ATTRS["ENCODING"] = "encoding"; ATTRS["PROMPT"] = "prompt"; ATTRS["NAME"] = "name"; ATTRS["COLOR"] = "color"; ATTRS["FACE"] = "face"; ATTRS["SIZE"] = "size"; })(ATTRS || (ATTRS = {})); /** * The mode of the document. * * @see {@link https://dom.spec.whatwg.org/#concept-document-limited-quirks} */ var DOCUMENT_MODE; (function(DOCUMENT_MODE) { DOCUMENT_MODE["NO_QUIRKS"] = "no-quirks"; DOCUMENT_MODE["QUIRKS"] = "quirks"; DOCUMENT_MODE["LIMITED_QUIRKS"] = "limited-quirks"; })(DOCUMENT_MODE || (DOCUMENT_MODE = {})); var TAG_NAMES; (function(TAG_NAMES) { TAG_NAMES["A"] = "a"; TAG_NAMES["ADDRESS"] = "address"; TAG_NAMES["ANNOTATION_XML"] = "annotation-xml"; TAG_NAMES["APPLET"] = "applet"; TAG_NAMES["AREA"] = "area"; TAG_NAMES["ARTICLE"] = "article"; TAG_NAMES["ASIDE"] = "aside"; TAG_NAMES["B"] = "b"; TAG_NAMES["BASE"] = "base"; TAG_NAMES["BASEFONT"] = "basefont"; TAG_NAMES["BGSOUND"] = "bgsound"; TAG_NAMES["BIG"] = "big"; TAG_NAMES["BLOCKQUOTE"] = "blockquote"; TAG_NAMES["BODY"] = "body"; TAG_NAMES["BR"] = "br"; TAG_NAMES["BUTTON"] = "button"; TAG_NAMES["CAPTION"] = "caption"; TAG_NAMES["CENTER"] = "center"; TAG_NAMES["CODE"] = "code"; TAG_NAMES["COL"] = "col"; TAG_NAMES["COLGROUP"] = "colgroup"; TAG_NAMES["DD"] = "dd"; TAG_NAMES["DESC"] = "desc"; TAG_NAMES["DETAILS"] = "details"; TAG_NAMES["DIALOG"] = "dialog"; TAG_NAMES["DIR"] = "dir"; TAG_NAMES["DIV"] = "div"; TAG_NAMES["DL"] = "dl"; TAG_NAMES["DT"] = "dt"; TAG_NAMES["EM"] = "em"; TAG_NAMES["EMBED"] = "embed"; TAG_NAMES["FIELDSET"] = "fieldset"; TAG_NAMES["FIGCAPTION"] = "figcaption"; TAG_NAMES["FIGURE"] = "figure"; TAG_NAMES["FONT"] = "font"; TAG_NAMES["FOOTER"] = "footer"; TAG_NAMES["FOREIGN_OBJECT"] = "foreignObject"; TAG_NAMES["FORM"] = "form"; TAG_NAMES["FRAME"] = "frame"; TAG_NAMES["FRAMESET"] = "frameset"; TAG_NAMES["H1"] = "h1"; TAG_NAMES["H2"] = "h2"; TAG_NAMES["H3"] = "h3"; TAG_NAMES["H4"] = "h4"; TAG_NAMES["H5"] = "h5"; TAG_NAMES["H6"] = "h6"; TAG_NAMES["HEAD"] = "head"; TAG_NAMES["HEADER"] = "header"; TAG_NAMES["HGROUP"] = "hgroup"; TAG_NAMES["HR"] = "hr"; TAG_NAMES["HTML"] = "html"; TAG_NAMES["I"] = "i"; TAG_NAMES["IMG"] = "img"; TAG_NAMES["IMAGE"] = "image"; TAG_NAMES["INPUT"] = "input"; TAG_NAMES["IFRAME"] = "iframe"; TAG_NAMES["KEYGEN"] = "keygen"; TAG_NAMES["LABEL"] = "label"; TAG_NAMES["LI"] = "li"; TAG_NAMES["LINK"] = "link"; TAG_NAMES["LISTING"] = "listing"; TAG_NAMES["MAIN"] = "main"; TAG_NAMES["MALIGNMARK"] = "malignmark"; TAG_NAMES["MARQUEE"] = "marquee"; TAG_NAMES["MATH"] = "math"; TAG_NAMES["MENU"] = "menu"; TAG_NAMES["META"] = "meta"; TAG_NAMES["MGLYPH"] = "mglyph"; TAG_NAMES["MI"] = "mi"; TAG_NAMES["MO"] = "mo"; TAG_NAMES["MN"] = "mn"; TAG_NAMES["MS"] = "ms"; TAG_NAMES["MTEXT"] = "mtext"; TAG_NAMES["NAV"] = "nav"; TAG_NAMES["NOBR"] = "nobr"; TAG_NAMES["NOFRAMES"] = "noframes"; TAG_NAMES["NOEMBED"] = "noembed"; TAG_NAMES["NOSCRIPT"] = "noscript"; TAG_NAMES["OBJECT"] = "object"; TAG_NAMES["OL"] = "ol"; TAG_NAMES["OPTGROUP"] = "optgroup"; TAG_NAMES["OPTION"] = "option"; TAG_NAMES["P"] = "p"; TAG_NAMES["PARAM"] = "param"; TAG_NAMES["PLAINTEXT"] = "plaintext"; TAG_NAMES["PRE"] = "pre"; TAG_NAMES["RB"] = "rb"; TAG_NAMES["RP"] = "rp"; TAG_NAMES["RT"] = "rt"; TAG_NAMES["RTC"] = "rtc"; TAG_NAMES["RUBY"] = "ruby"; TAG_NAMES["S"] = "s"; TAG_NAMES["SCRIPT"] = "script"; TAG_NAMES["SEARCH"] = "search"; TAG_NAMES["SECTION"] = "section"; TAG_NAMES["SELECT"] = "select"; TAG_NAMES["SOURCE"] = "source"; TAG_NAMES["SMALL"] = "small"; TAG_NAMES["SPAN"] = "span"; TAG_NAMES["STRIKE"] = "strike"; TAG_NAMES["STRONG"] = "strong"; TAG_NAMES["STYLE"] = "style"; TAG_NAMES["SUB"] = "sub"; TAG_NAMES["SUMMARY"] = "summary"; TAG_NAMES["SUP"] = "sup"; TAG_NAMES["TABLE"] = "table"; TAG_NAMES["TBODY"] = "tbody"; TAG_NAMES["TEMPLATE"] = "template"; TAG_NAMES["TEXTAREA"] = "textarea"; TAG_NAMES["TFOOT"] = "tfoot"; TAG_NAMES["TD"] = "td"; TAG_NAMES["TH"] = "th"; TAG_NAMES["THEAD"] = "thead"; TAG_NAMES["TITLE"] = "title"; TAG_NAMES["TR"] = "tr"; TAG_NAMES["TRACK"] = "track"; TAG_NAMES["TT"] = "tt"; TAG_NAMES["U"] = "u"; TAG_NAMES["UL"] = "ul"; TAG_NAMES["SVG"] = "svg"; TAG_NAMES["VAR"] = "var"; TAG_NAMES["WBR"] = "wbr"; TAG_NAMES["XMP"] = "xmp"; })(TAG_NAMES || (TAG_NAMES = {})); /** * Tag IDs are numeric IDs for known tag names. * * We use tag IDs to improve the performance of tag name comparisons. */ var TAG_ID; (function(TAG_ID) { TAG_ID[TAG_ID["UNKNOWN"] = 0] = "UNKNOWN"; TAG_ID[TAG_ID["A"] = 1] = "A"; TAG_ID[TAG_ID["ADDRESS"] = 2] = "ADDRESS"; TAG_ID[TAG_ID["ANNOTATION_XML"] = 3] = "ANNOTATION_XML"; TAG_ID[TAG_ID["APPLET"] = 4] = "APPLET"; TAG_ID[TAG_ID["AREA"] = 5] = "AREA"; TAG_ID[TAG_ID["ARTICLE"] = 6] = "ARTICLE"; TAG_ID[TAG_ID["ASIDE"] = 7] = "ASIDE"; TAG_ID[TAG_ID["B"] = 8] = "B"; TAG_ID[TAG_ID["BASE"] = 9] = "BASE"; TAG_ID[TAG_ID["BASEFONT"] = 10] = "BASEFONT"; TAG_ID[TAG_ID["BGSOUND"] = 11] = "BGSOUND"; TAG_ID[TAG_ID["BIG"] = 12] = "BIG"; TAG_ID[TAG_ID["BLOCKQUOTE"] = 13] = "BLOCKQUOTE"; TAG_ID[TAG_ID["BODY"] = 14] = "BODY"; TAG_ID[TAG_ID["BR"] = 15] = "BR"; TAG_ID[TAG_ID["BUTTON"] = 16] = "BUTTON"; TAG_ID[TAG_ID["CAPTION"] = 17] = "CAPTION"; TAG_ID[TAG_ID["CENTER"] = 18] = "CENTER"; TAG_ID[TAG_ID["CODE"] = 19] = "CODE"; TAG_ID[TAG_ID["COL"] = 20] = "COL"; TAG_ID[TAG_ID["COLGROUP"] = 21] = "COLGROUP"; TAG_ID[TAG_ID["DD"] = 22] = "DD"; TAG_ID[TAG_ID["DESC"] = 23] = "DESC"; TAG_ID[TAG_ID["DETAILS"] = 24] = "DETAILS"; TAG_ID[TAG_ID["DIALOG"] = 25] = "DIALOG"; TAG_ID[TAG_ID["DIR"] = 26] = "DIR"; TAG_ID[TAG_ID["DIV"] = 27] = "DIV"; TAG_ID[TAG_ID["DL"] = 28] = "DL"; TAG_ID[TAG_ID["DT"] = 29] = "DT"; TAG_ID[TAG_ID["EM"] = 30] = "EM"; TAG_ID[TAG_ID["EMBED"] = 31] = "EMBED"; TAG_ID[TAG_ID["FIELDSET"] = 32] = "FIELDSET"; TAG_ID[TAG_ID["FIGCAPTION"] = 33] = "FIGCAPTION"; TAG_ID[TAG_ID["FIGURE"] = 34] = "FIGURE"; TAG_ID[TAG_ID["FONT"] = 35] = "FONT"; TAG_ID[TAG_ID["FOOTER"] = 36] = "FOOTER"; TAG_ID[TAG_ID["FOREIGN_OBJECT"] = 37] = "FOREIGN_OBJECT"; TAG_ID[TAG_ID["FORM"] = 38] = "FORM"; TAG_ID[TAG_ID["FRAME"] = 39] = "FRAME"; TAG_ID[TAG_ID["FRAMESET"] = 40] = "FRAMESET"; TAG_ID[TAG_ID["H1"] = 41] = "H1"; TAG_ID[TAG_ID["H2"] = 42] = "H2"; TAG_ID[TAG_ID["H3"] = 43] = "H3"; TAG_ID[TAG_ID["H4"] = 44] = "H4"; TAG_ID[TAG_ID["H5"] = 45] = "H5"; TAG_ID[TAG_ID["H6"] = 46] = "H6"; TAG_ID[TAG_ID["HEAD"] = 47] = "HEAD"; TAG_ID[TAG_ID["HEADER"] = 48] = "HEADER"; TAG_ID[TAG_ID["HGROUP"] = 49] = "HGROUP"; TAG_ID[TAG_ID["HR"] = 50] = "HR"; TAG_ID[TAG_ID["HTML"] = 51] = "HTML"; TAG_ID[TAG_ID["I"] = 52] = "I"; TAG_ID[TAG_ID["IMG"] = 53] = "IMG"; TAG_ID[TAG_ID["IMAGE"] = 54] = "IMAGE"; TAG_ID[TAG_ID["INPUT"] = 55] = "INPUT"; TAG_ID[TAG_ID["IFRAME"] = 56] = "IFRAME"; TAG_ID[TAG_ID["KEYGEN"] = 57] = "KEYGEN"; TAG_ID[TAG_ID["LABEL"] = 58] = "LABEL"; TAG_ID[TAG_ID["LI"] = 59] = "LI"; TAG_ID[TAG_ID["LINK"] = 60] = "LINK"; TAG_ID[TAG_ID["LISTING"] = 61] = "LISTING"; TAG_ID[TAG_ID["MAIN"] = 62] = "MAIN"; TAG_ID[TAG_ID["MALIGNMARK"] = 63] = "MALIGNMARK"; TAG_ID[TAG_ID["MARQUEE"] = 64] = "MARQUEE"; TAG_ID[TAG_ID["MATH"] = 65] = "MATH"; TAG_ID[TAG_ID["MENU"] = 66] = "MENU"; TAG_ID[TAG_ID["META"] = 67] = "META"; TAG_ID[TAG_ID["MGLYPH"] = 68] = "MGLYPH"; TAG_ID[TAG_ID["MI"] = 69] = "MI"; TAG_ID[TAG_ID["MO"] = 70] = "MO"; TAG_ID[TAG_ID["MN"] = 71] = "MN"; TAG_ID[TAG_ID["MS"] = 72] = "MS"; TAG_ID[TAG_ID["MTEXT"] = 73] = "MTEXT"; TAG_ID[TAG_ID["NAV"] = 74] = "NAV"; TAG_ID[TAG_ID["NOBR"] = 75] = "NOBR"; TAG_ID[TAG_ID["NOFRAMES"] = 76] = "NOFRAMES"; TAG_ID[TAG_ID["NOEMBED"] = 77] = "NOEMBED"; TAG_ID[TAG_ID["NOSCRIPT"] = 78] = "NOSCRIPT"; TAG_ID[TAG_ID["OBJECT"] = 79] = "OBJECT"; TAG_ID[TAG_ID["OL"] = 80] = "OL"; TAG_ID[TAG_ID["OPTGROUP"] = 81] = "OPTGROUP"; TAG_ID[TAG_ID["OPTION"] = 82] = "OPTION"; TAG_ID[TAG_ID["P"] = 83] = "P"; TAG_ID[TAG_ID["PARAM"] = 84] = "PARAM"; TAG_ID[TAG_ID["PLAINTEXT"] = 85] = "PLAINTEXT"; TAG_ID[TAG_ID["PRE"] = 86] = "PRE"; TAG_ID[TAG_ID["RB"] = 87] = "RB"; TAG_ID[TAG_ID["RP"] = 88] = "RP"; TAG_ID[TAG_ID["RT"] = 89] = "RT"; TAG_ID[TAG_ID["RTC"] = 90] = "RTC"; TAG_ID[TAG_ID["RUBY"] = 91] = "RUBY"; TAG_ID[TAG_ID["S"] = 92] = "S"; TAG_ID[TAG_ID["SCRIPT"] = 93] = "SCRIPT"; TAG_ID[TAG_ID["SEARCH"] = 94] = "SEARCH"; TAG_ID[TAG_ID["SECTION"] = 95] = "SECTION"; TAG_ID[TAG_ID["SELECT"] = 96] = "SELECT"; TAG_ID[TAG_ID["SOURCE"] = 97] = "SOURCE"; TAG_ID[TAG_ID["SMALL"] = 98] = "SMALL"; TAG_ID[TAG_ID["SPAN"] = 99] = "SPAN"; TAG_ID[TAG_ID["STRIKE"] = 100] = "STRIKE"; TAG_ID[TAG_ID["STRONG"] = 101] = "STRONG"; TAG_ID[TAG_ID["STYLE"] = 102] = "STYLE"; TAG_ID[TAG_ID["SUB"] = 103] = "SUB"; TAG_ID[TAG_ID["SUMMARY"] = 104] = "SUMMARY"; TAG_ID[TAG_ID["SUP"] = 105] = "SUP"; TAG_ID[TAG_ID["TABLE"] = 106] = "TABLE"; TAG_ID[TAG_ID["TBODY"] = 107] = "TBODY"; TAG_ID[TAG_ID["TEMPLATE"] = 108] = "TEMPLATE"; TAG_ID[TAG_ID["TEXTAREA"] = 109] = "TEXTAREA"; TAG_ID[TAG_ID["TFOOT"] = 110] = "TFOOT"; TAG_ID[TAG_ID["TD"] = 111] = "TD"; TAG_ID[TAG_ID["TH"] = 112] = "TH"; TAG_ID[TAG_ID["THEAD"] = 113] = "THEAD"; TAG_ID[TAG_ID["TITLE"] = 114] = "TITLE"; TAG_ID[TAG_ID["TR"] = 115] = "TR"; TAG_ID[TAG_ID["TRACK"] = 116] = "TRACK"; TAG_ID[TAG_ID["TT"] = 117] = "TT"; TAG_ID[TAG_ID["U"] = 118] = "U"; TAG_ID[TAG_ID["UL"] = 119] = "UL"; TAG_ID[TAG_ID["SVG"] = 120] = "SVG"; TAG_ID[TAG_ID["VAR"] = 121] = "VAR"; TAG_ID[TAG_ID["WBR"] = 122] = "WBR"; TAG_ID[TAG_ID["XMP"] = 123] = "XMP"; })(TAG_ID || (TAG_ID = {})); const TAG_NAME_TO_ID = /* @__PURE__ */ new Map([ [TAG_NAMES.A, TAG_ID.A], [TAG_NAMES.ADDRESS, TAG_ID.ADDRESS], [TAG_NAMES.ANNOTATION_XML, TAG_ID.ANNOTATION_XML], [TAG_NAMES.APPLET, TAG_ID.APPLET], [TAG_NAMES.AREA, TAG_ID.AREA], [TAG_NAMES.ARTICLE, TAG_ID.ARTICLE], [TAG_NAMES.ASIDE, TAG_ID.ASIDE], [TAG_NAMES.B, TAG_ID.B], [TAG_NAMES.BASE, TAG_ID.BASE], [TAG_NAMES.BASEFONT, TAG_ID.BASEFONT], [TAG_NAMES.BGSOUND, TAG_ID.BGSOUND], [TAG_NAMES.BIG, TAG_ID.BIG], [TAG_NAMES.BLOCKQUOTE, TAG_ID.BLOCKQUOTE], [TAG_NAMES.BODY, TAG_ID.BODY], [TAG_NAMES.BR, TAG_ID.BR], [TAG_NAMES.BUTTON, TAG_ID.BUTTON], [TAG_NAMES.CAPTION, TAG_ID.CAPTION], [TAG_NAMES.CENTER, TAG_ID.CENTER], [TAG_NAMES.CODE, TAG_ID.CODE], [TAG_NAMES.COL, TAG_ID.COL], [TAG_NAMES.COLGROUP, TAG_ID.COLGROUP], [TAG_NAMES.DD, TAG_ID.DD], [TAG_NAMES.DESC, TAG_ID.DESC], [TAG_NAMES.DETAILS, TAG_ID.DETAILS], [TAG_NAMES.DIALOG, TAG_ID.DIALOG], [TAG_NAMES.DIR, TAG_ID.DIR], [TAG_NAMES.DIV, TAG_ID.DIV], [TAG_NAMES.DL, TAG_ID.DL], [TAG_NAMES.DT, TAG_ID.DT], [TAG_NAMES.EM, TAG_ID.EM], [TAG_NAMES.EMBED, TAG_ID.EMBED], [TAG_NAMES.FIELDSET, TAG_ID.FIELDSET], [TAG_NAMES.FIGCAPTION, TAG_ID.FIGCAPTION], [TAG_NAMES.FIGURE, TAG_ID.FIGURE], [TAG_NAMES.FONT, TAG_ID.FONT], [TAG_NAMES.FOOTER, TAG_ID.FOOTER], [TAG_NAMES.FOREIGN_OBJECT, TAG_ID.FOREIGN_OBJECT], [TAG_NAMES.FORM, TAG_ID.FORM], [TAG_NAMES.FRAME, TAG_ID.FRAME], [TAG_NAMES.FRAMESET, TAG_ID.FRAMESET], [TAG_NAMES.H1, TAG_ID.H1], [TAG_NAMES.H2, TAG_ID.H2], [TAG_NAMES.H3, TAG_ID.H3], [TAG_NAMES.H4, TAG_ID.H4], [TAG_NAMES.H5, TAG_ID.H5], [TAG_NAMES.H6, TAG_ID.H6], [TAG_NAMES.HEAD, TAG_ID.HEAD], [TAG_NAMES.HEADER, TAG_ID.HEADER], [TAG_NAMES.HGROUP, TAG_ID.HGROUP], [TAG_NAMES.HR, TAG_ID.HR], [TAG_NAMES.HTML, TAG_ID.HTML], [TAG_NAMES.I, TAG_ID.I], [TAG_NAMES.IMG, TAG_ID.IMG], [TAG_NAMES.IMAGE, TAG_ID.IMAGE], [TAG_NAMES.INPUT, TAG_ID.INPUT], [TAG_NAMES.IFRAME, TAG_ID.IFRAME], [TAG_NAMES.KEYGEN, TAG_ID.KEYGEN], [TAG_NAMES.LABEL, TAG_ID.LABEL], [TAG_NAMES.LI, TAG_ID.LI], [TAG_NAMES.LINK, TAG_ID.LINK], [TAG_NAMES.LISTING, TAG_ID.LISTING], [TAG_NAMES.MAIN, TAG_ID.MAIN], [TAG_NAMES.MALIGNMARK, TAG_ID.MALIGNMARK], [TAG_NAMES.MARQUEE, TAG_ID.MARQUEE], [TAG_NAMES.MATH, TAG_ID.MATH], [TAG_NAMES.MENU, TAG_ID.MENU], [TAG_NAMES.META, TAG_ID.META], [TAG_NAMES.MGLYPH, TAG_ID.MGLYPH], [TAG_NAMES.MI, TAG_ID.MI], [TAG_NAMES.MO, TAG_ID.MO], [TAG_NAMES.MN, TAG_ID.MN], [TAG_NAMES.MS, TAG_ID.MS], [TAG_NAMES.MTEXT, TAG_ID.MTEXT], [TAG_NAMES.NAV, TAG_ID.NAV], [TAG_NAMES.NOBR, TAG_ID.NOBR], [TAG_NAMES.NOFRAMES, TAG_ID.NOFRAMES], [TAG_NAMES.NOEMBED, TAG_ID.NOEMBED], [TAG_NAMES.NOSCRIPT, TAG_ID.NOSCRIPT], [TAG_NAMES.OBJECT, TAG_ID.OBJECT], [TAG_NAMES.OL, TAG_ID.OL], [TAG_NAMES.OPTGROUP, TAG_ID.OPTGROUP], [TAG_NAMES.OPTION, TAG_ID.OPTION], [TAG_NAMES.P, TAG_ID.P], [TAG_NAMES.PARAM, TAG_ID.PARAM], [TAG_NAMES.PLAINTEXT, TAG_ID.PLAINTEXT], [TAG_NAMES.PRE, TAG_ID.PRE], [TAG_NAMES.RB, TAG_ID.RB], [TAG_NAMES.RP, TAG_ID.RP], [TAG_NAMES.RT, TAG_ID.RT], [TAG_NAMES.RTC, TAG_ID.RTC], [TAG_NAMES.RUBY, TAG_ID.RUBY], [TAG_NAMES.S, TAG_ID.S], [TAG_NAMES.SCRIPT, TAG_ID.SCRIPT], [TAG_NAMES.SEARCH, TAG_ID.SEARCH], [TAG_NAMES.SECTION, TAG_ID.SECTION], [TAG_NAMES.SELECT, TAG_ID.SELECT], [TAG_NAMES.SOURCE, TAG_ID.SOURCE], [TAG_NAMES.SMALL, TAG_ID.SMALL], [TAG_NAMES.SPAN, TAG_ID.SPAN], [TAG_NAMES.STRIKE, TAG_ID.STRIKE], [TAG_NAMES.STRONG, TAG_ID.STRONG], [TAG_NAMES.STYLE, TAG_ID.STYLE], [TAG_NAMES.SUB, TAG_ID.SUB], [TAG_NAMES.SUMMARY, TAG_ID.SUMMARY], [TAG_NAMES.SUP, TAG_ID.SUP], [TAG_NAMES.TABLE, TAG_ID.TABLE], [TAG_NAMES.TBODY, TAG_ID.TBODY], [TAG_NAMES.TEMPLATE, TAG_ID.TEMPLATE], [TAG_NAMES.TEXTAREA, TAG_ID.TEXTAREA], [TAG_NAMES.TFOOT, TAG_ID.TFOOT], [TAG_NAMES.TD, TAG_ID.TD], [TAG_NAMES.TH, TAG_ID.TH], [TAG_NAMES.THEAD, TAG_ID.THEAD], [TAG_NAMES.TITLE, TAG_ID.TITLE], [TAG_NAMES.TR, TAG_ID.TR], [TAG_NAMES.TRACK, TAG_ID.TRACK], [TAG_NAMES.TT, TAG_ID.TT], [TAG_NAMES.U, TAG_ID.U], [TAG_NAMES.UL, TAG_ID.UL], [TAG_NAMES.SVG, TAG_ID.SVG], [TAG_NAMES.VAR, TAG_ID.VAR], [TAG_NAMES.WBR, TAG_ID.WBR], [TAG_NAMES.XMP, TAG_ID.XMP] ]); function getTagID(tagName) { var _a; return (_a = TAG_NAME_TO_ID.get(tagName)) !== null && _a !== void 0 ? _a : TAG_ID.UNKNOWN; } const $ = TAG_ID; const SPECIAL_ELEMENTS = { [NS.HTML]: /* @__PURE__ */ new Set([ $.ADDRESS, $.APPLET, $.AREA, $.ARTICLE, $.ASIDE, $.BASE, $.BASEFONT, $.BGSOUND, $.BLOCKQUOTE, $.BODY, $.BR, $.BUTTON, $.CAPTION, $.CENTER, $.COL, $.COLGROUP, $.DD, $.DETAILS, $.DIR, $.DIV, $.DL, $.DT, $.EMBED, $.FIELDSET, $.FIGCAPTION, $.FIGURE, $.FOOTER, $.FORM, $.FRAME, $.FRAMESET, $.H1, $.H2, $.H3, $.H4, $.H5, $.H6, $.HEAD, $.HEADER, $.HGROUP, $.HR, $.HTML, $.IFRAME, $.IMG, $.INPUT, $.LI, $.LINK, $.LISTING, $.MAIN, $.MARQUEE, $.MENU, $.META, $.NAV, $.NOEMBED, $.NOFRAMES, $.NOSCRIPT, $.OBJECT, $.OL, $.P, $.PARAM, $.PLAINTEXT, $.PRE, $.SCRIPT, $.SECTION, $.SELECT, $.SOURCE, $.STYLE, $.SUMMARY, $.TABLE, $.TBODY, $.TD, $.TEMPLATE, $.TEXTAREA, $.TFOOT, $.TH, $.THEAD, $.TITLE, $.TR, $.TRACK, $.UL, $.WBR, $.XMP ]), [NS.MATHML]: /* @__PURE__ */ new Set([ $.MI, $.MO, $.MN, $.MS, $.MTEXT, $.ANNOTATION_XML ]), [NS.SVG]: /* @__PURE__ */ new Set([ $.TITLE, $.FOREIGN_OBJECT, $.DESC ]), [NS.XLINK]: /* @__PURE__ */ new Set(), [NS.XML]: /* @__PURE__ */ new Set(), [NS.XMLNS]: /* @__PURE__ */ new Set() }; const NUMBERED_HEADERS$1 = /* @__PURE__ */ new Set([ $.H1, $.H2, $.H3, $.H4, $.H5, $.H6 ]); // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/tokenizer/index.js const ATTR_NAME_SET_THRESHOLD = 64; var State; (function(State) { State[State["DATA"] = 0] = "DATA"; State[State["RCDATA"] = 1] = "RCDATA"; State[State["RAWTEXT"] = 2] = "RAWTEXT"; State[State["SCRIPT_DATA"] = 3] = "SCRIPT_DATA"; State[State["PLAINTEXT"] = 4] = "PLAINTEXT"; State[State["TAG_OPEN"] = 5] = "TAG_OPEN"; State[State["END_TAG_OPEN"] = 6] = "END_TAG_OPEN"; State[State["TAG_NAME"] = 7] = "TAG_NAME"; State[State["RCDATA_LESS_THAN_SIGN"] = 8] = "RCDATA_LESS_THAN_SIGN"; State[State["RCDATA_END_TAG_OPEN"] = 9] = "RCDATA_END_TAG_OPEN"; State[State["RCDATA_END_TAG_NAME"] = 10] = "RCDATA_END_TAG_NAME"; State[State["RAWTEXT_LESS_THAN_SIGN"] = 11] = "RAWTEXT_LESS_THAN_SIGN"; State[State["RAWTEXT_END_TAG_OPEN"] = 12] = "RAWTEXT_END_TAG_OPEN"; State[State["RAWTEXT_END_TAG_NAME"] = 13] = "RAWTEXT_END_TAG_NAME"; State[State["SCRIPT_DATA_LESS_THAN_SIGN"] = 14] = "SCRIPT_DATA_LESS_THAN_SIGN"; State[State["SCRIPT_DATA_END_TAG_OPEN"] = 15] = "SCRIPT_DATA_END_TAG_OPEN"; State[State["SCRIPT_DATA_END_TAG_NAME"] = 16] = "SCRIPT_DATA_END_TAG_NAME"; State[State["SCRIPT_DATA_ESCAPE_START"] = 17] = "SCRIPT_DATA_ESCAPE_START"; State[State["SCRIPT_DATA_ESCAPE_START_DASH"] = 18] = "SCRIPT_DATA_ESCAPE_START_DASH"; State[State["SCRIPT_DATA_ESCAPED"] = 19] = "SCRIPT_DATA_ESCAPED"; State[State["SCRIPT_DATA_ESCAPED_DASH"] = 20] = "SCRIPT_DATA_ESCAPED_DASH"; State[State["SCRIPT_DATA_ESCAPED_DASH_DASH"] = 21] = "SCRIPT_DATA_ESCAPED_DASH_DASH"; State[State["SCRIPT_DATA_ESCAPED_LESS_THAN_SIGN"] = 22] = "SCRIPT_DATA_ESCAPED_LESS_THAN_SIGN"; State[State["SCRIPT_DATA_ESCAPED_END_TAG_OPEN"] = 23] = "SCRIPT_DATA_ESCAPED_END_TAG_OPEN"; State[State["SCRIPT_DATA_ESCAPED_END_TAG_NAME"] = 24] = "SCRIPT_DATA_ESCAPED_END_TAG_NAME"; State[State["SCRIPT_DATA_DOUBLE_ESCAPE_START"] = 25] = "SCRIPT_DATA_DOUBLE_ESCAPE_START"; State[State["SCRIPT_DATA_DOUBLE_ESCAPED"] = 26] = "SCRIPT_DATA_DOUBLE_ESCAPED"; State[State["SCRIPT_DATA_DOUBLE_ESCAPED_DASH"] = 27] = "SCRIPT_DATA_DOUBLE_ESCAPED_DASH"; State[State["SCRIPT_DATA_DOUBLE_ESCAPED_DASH_DASH"] = 28] = "SCRIPT_DATA_DOUBLE_ESCAPED_DASH_DASH"; State[State["SCRIPT_DATA_DOUBLE_ESCAPED_LESS_THAN_SIGN"] = 29] = "SCRIPT_DATA_DOUBLE_ESCAPED_LESS_THAN_SIGN"; State[State["SCRIPT_DATA_DOUBLE_ESCAPE_END"] = 30] = "SCRIPT_DATA_DOUBLE_ESCAPE_END"; State[State["BEFORE_ATTRIBUTE_NAME"] = 31] = "BEFORE_ATTRIBUTE_NAME"; State[State["ATTRIBUTE_NAME"] = 32] = "ATTRIBUTE_NAME"; State[State["AFTER_ATTRIBUTE_NAME"] = 33] = "AFTER_ATTRIBUTE_NAME"; State[State["BEFORE_ATTRIBUTE_VALUE"] = 34] = "BEFORE_ATTRIBUTE_VALUE"; State[State["ATTRIBUTE_VALUE_DOUBLE_QUOTED"] = 35] = "ATTRIBUTE_VALUE_DOUBLE_QUOTED"; State[State["ATTRIBUTE_VALUE_SINGLE_QUOTED"] = 36] = "ATTRIBUTE_VALUE_SINGLE_QUOTED"; State[State["ATTRIBUTE_VALUE_UNQUOTED"] = 37] = "ATTRIBUTE_VALUE_UNQUOTED"; State[State["AFTER_ATTRIBUTE_VALUE_QUOTED"] = 38] = "AFTER_ATTRIBUTE_VALUE_QUOTED"; State[State["SELF_CLOSING_START_TAG"] = 39] = "SELF_CLOSING_START_TAG"; State[State["BOGUS_COMMENT"] = 40] = "BOGUS_COMMENT"; State[State["MARKUP_DECLARATION_OPEN"] = 41] = "MARKUP_DECLARATION_OPEN"; State[State["COMMENT_START"] = 42] = "COMMENT_START"; State[State["COMMENT_START_DASH"] = 43] = "COMMENT_START_DASH"; State[State["COMMENT"] = 44] = "COMMENT"; State[State["COMMENT_LESS_THAN_SIGN"] = 45] = "COMMENT_LESS_THAN_SIGN"; State[State["COMMENT_LESS_THAN_SIGN_BANG"] = 46] = "COMMENT_LESS_THAN_SIGN_BANG"; State[State["COMMENT_LESS_THAN_SIGN_BANG_DASH"] = 47] = "COMMENT_LESS_THAN_SIGN_BANG_DASH"; State[State["COMMENT_LESS_THAN_SIGN_BANG_DASH_DASH"] = 48] = "COMMENT_LESS_THAN_SIGN_BANG_DASH_DASH"; State[State["COMMENT_END_DASH"] = 49] = "COMMENT_END_DASH"; State[State["COMMENT_END"] = 50] = "COMMENT_END"; State[State["COMMENT_END_BANG"] = 51] = "COMMENT_END_BANG"; State[State["DOCTYPE"] = 52] = "DOCTYPE"; State[State["BEFORE_DOCTYPE_NAME"] = 53] = "BEFORE_DOCTYPE_NAME"; State[State["DOCTYPE_NAME"] = 54] = "DOCTYPE_NAME"; State[State["AFTER_DOCTYPE_NAME"] = 55] = "AFTER_DOCTYPE_NAME"; State[State["AFTER_DOCTYPE_PUBLIC_KEYWORD"] = 56] = "AFTER_DOCTYPE_PUBLIC_KEYWORD"; State[State["BEFORE_DOCTYPE_PUBLIC_IDENTIFIER"] = 57] = "BEFORE_DOCTYPE_PUBLIC_IDENTIFIER"; State[State["DOCTYPE_PUBLIC_IDENTIFIER_DOUBLE_QUOTED"] = 58] = "DOCTYPE_PUBLIC_IDENTIFIER_DOUBLE_QUOTED"; State[State["DOCTYPE_PUBLIC_IDENTIFIER_SINGLE_QUOTED"] = 59] = "DOCTYPE_PUBLIC_IDENTIFIER_SINGLE_QUOTED"; State[State["AFTER_DOCTYPE_PUBLIC_IDENTIFIER"] = 60] = "AFTER_DOCTYPE_PUBLIC_IDENTIFIER"; State[State["BETWEEN_DOCTYPE_PUBLIC_AND_SYSTEM_IDENTIFIERS"] = 61] = "BETWEEN_DOCTYPE_PUBLIC_AND_SYSTEM_IDENTIFIERS"; State[State["AFTER_DOCTYPE_SYSTEM_KEYWORD"] = 62] = "AFTER_DOCTYPE_SYSTEM_KEYWORD"; State[State["BEFORE_DOCTYPE_SYSTEM_IDENTIFIER"] = 63] = "BEFORE_DOCTYPE_SYSTEM_IDENTIFIER"; State[State["DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED"] = 64] = "DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED"; State[State["DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED"] = 65] = "DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED"; State[State["AFTER_DOCTYPE_SYSTEM_IDENTIFIER"] = 66] = "AFTER_DOCTYPE_SYSTEM_IDENTIFIER"; State[State["BOGUS_DOCTYPE"] = 67] = "BOGUS_DOCTYPE"; State[State["CDATA_SECTION"] = 68] = "CDATA_SECTION"; State[State["CDATA_SECTION_BRACKET"] = 69] = "CDATA_SECTION_BRACKET"; State[State["CDATA_SECTION_END"] = 70] = "CDATA_SECTION_END"; State[State["CHARACTER_REFERENCE"] = 71] = "CHARACTER_REFERENCE"; State[State["AMBIGUOUS_AMPERSAND"] = 72] = "AMBIGUOUS_AMPERSAND"; })(State || (State = {})); const TokenizerMode = { DATA: State.DATA, RCDATA: State.RCDATA, RAWTEXT: State.RAWTEXT, SCRIPT_DATA: State.SCRIPT_DATA, PLAINTEXT: State.PLAINTEXT, CDATA_SECTION: State.CDATA_SECTION }; function isAsciiDigit(cp) { return cp >= CODE_POINTS.DIGIT_0 && cp <= CODE_POINTS.DIGIT_9; } function isAsciiUpper(cp) { return cp >= CODE_POINTS.LATIN_CAPITAL_A && cp <= CODE_POINTS.LATIN_CAPITAL_Z; } function isAsciiLower(cp) { return cp >= CODE_POINTS.LATIN_SMALL_A && cp <= CODE_POINTS.LATIN_SMALL_Z; } function isAsciiLetter(cp) { return isAsciiLower(cp) || isAsciiUpper(cp); } function isAsciiAlphaNumeric(cp) { return isAsciiLetter(cp) || isAsciiDigit(cp); } function toAsciiLower(cp) { return cp + 32; } function isWhitespace(cp) { return cp === CODE_POINTS.SPACE || cp === CODE_POINTS.LINE_FEED || cp === CODE_POINTS.TABULATION || cp === CODE_POINTS.FORM_FEED || cp === CODE_POINTS.CARRIAGE_RETURN; } function isScriptDataDoubleEscapeSequenceEnd(cp) { return isWhitespace(cp) || cp === CODE_POINTS.SOLIDUS || cp === CODE_POINTS.GREATER_THAN_SIGN; } function getErrorForNumericCharacterReference(code) { if (code === CODE_POINTS.NULL) return ERR.nullCharacterReference; else if (code > 1114111) return ERR.characterReferenceOutsideUnicodeRange; else if (isSurrogate(code)) return ERR.surrogateCharacterReference; else if (isUndefinedCodePoint(code)) return ERR.noncharacterCharacterReference; else if (isControlCodePoint(code) || code === CODE_POINTS.CARRIAGE_RETURN) return ERR.controlCharacterReference; return null; } var Tokenizer = class { constructor(options, handler) { this.options = options; this.handler = handler; this.paused = false; /** Ensures that the parsing loop isn't run multiple times at once. */ this.inLoop = false; /** * Indicates that the current adjusted node exists, is not an element in the HTML namespace, * and that it is not an integration point for either MathML or HTML. * * @see {@link https://html.spec.whatwg.org/multipage/parsing.html#tree-construction} */ this.inForeignNode = false; this.lastStartTagName = ""; this.active = false; this.state = State.DATA; this.returnState = State.DATA; this.entityStartPos = 0; this.consumedAfterSnapshot = -1; this.currentCharacterToken = null; this.currentToken = null; this.currentAttr = { name: "", value: "" }; this.currentAttrLocation = null; this.currentAttrNames = null; /** * `[start, end)` of `preprocessor.html` still to be appended to the attribute value, comment data or character * token being built (`_flushRun`): input that is used as is is appended as one slice, not a code point at a time. */ this.runStart = 0; this.runEnd = 0; this.preprocessor = new Preprocessor(handler); this.currentLocation = this.getCurrentLocation(-1); this.entityDecoder = new HtmlEntityDecoder((cp, consumed) => { this.preprocessor.pos = this.entityStartPos + consumed - 1; if (!this._isCharacterReferenceInAttribute()) this._ensureCharacterToken(isWhitespace(cp) ? TokenType.WHITESPACE_CHARACTER : cp === CODE_POINTS.NULL ? TokenType.NULL_CHARACTER : TokenType.CHARACTER); this._extendRunWith(String.fromCodePoint(cp), 0); this.entityStartPos = this.preprocessor.pos - consumed + 1; }, handler.onParseError ? { missingSemicolonAfterCharacterReference: () => { this._err(ERR.missingSemicolonAfterCharacterReference, 1); }, absenceOfDigitsInNumericCharacterReference: (consumed) => { this._err(ERR.absenceOfDigitsInNumericCharacterReference, this.entityStartPos - this.preprocessor.pos + consumed); }, validateNumericCharacterReference: (code) => { const error = getErrorForNumericCharacterReference(code); if (error) this._err(error, 1); } } : void 0); } _err(code, cpOffset = 0) { var _a, _b; (_b = (_a = this.handler).onParseError) === null || _b === void 0 || _b.call(_a, this.preprocessor.getError(code, cpOffset)); } getCurrentLocation(offset) { if (!this.options.sourceCodeLocationInfo) return null; return { startLine: this.preprocessor.line, startCol: this.preprocessor.col - offset, startOffset: this.preprocessor.offset - offset, endLine: -1, endCol: -1, endOffset: -1 }; } _runParsingLoop() { if (this.inLoop) return; this.inLoop = true; while (this.active && !this.paused) { this.consumedAfterSnapshot = 0; const cp = this._consume(); if (!this._ensureHibernation()) this._callState(cp); } this.inLoop = false; } /** Emit buffered character tokens without completing the current token or emitting EOF. */ flushCharacters() { var _a; if (this.inLoop) throw new Error("Cannot flush characters from a tokenizer callback"); const location = (_a = this.currentCharacterToken) === null || _a === void 0 ? void 0 : _a.location; let nextLocation = null; if (location) { nextLocation = this.getCharacterTokenEndLocation(location); this.currentLocation = nextLocation; } this.inLoop = true; try { this._emitCurrentCharacterToken(nextLocation); } finally { this.inLoop = false; } this._runParsingLoop(); } getCharacterTokenEndLocation(location) { const endOffset = this.getCharacterTokenEndOffset(); const html = this.preprocessor.html.slice(location.startOffset - this.preprocessor.droppedBufferSize, endOffset - this.preprocessor.droppedBufferSize); let line = location.startLine; let lastLineBreak = -1; for (let i = html.indexOf("\n"); i !== -1; i = html.indexOf("\n", i + 1)) { line++; lastLineBreak = i; } for (let i = html.indexOf("\r"); i !== -1; i = html.indexOf("\r", i + 1)) if (html.charCodeAt(i + 1) !== CODE_POINTS.LINE_FEED) { line++; lastLineBreak = Math.max(lastLineBreak, i); } return { startLine: line, startCol: lastLineBreak === -1 ? location.startCol + html.length : html.length - lastLineBreak, startOffset: endOffset, endLine: -1, endCol: -1, endOffset: -1 }; } getCharacterTokenEndOffset() { var _a; const end = this.preprocessor.droppedBufferSize + this.preprocessor.pos + 1; const tokenLocation = (_a = this.currentToken) === null || _a === void 0 ? void 0 : _a.location; switch (this.state) { case State.TAG_OPEN: case State.RCDATA_LESS_THAN_SIGN: case State.RAWTEXT_LESS_THAN_SIGN: case State.SCRIPT_DATA_LESS_THAN_SIGN: case State.SCRIPT_DATA_ESCAPED_LESS_THAN_SIGN: case State.CDATA_SECTION_BRACKET: return end - 1; case State.END_TAG_OPEN: case State.MARKUP_DECLARATION_OPEN: case State.RCDATA_END_TAG_OPEN: case State.RCDATA_END_TAG_NAME: case State.RAWTEXT_END_TAG_OPEN: case State.RAWTEXT_END_TAG_NAME: case State.SCRIPT_DATA_END_TAG_OPEN: case State.SCRIPT_DATA_END_TAG_NAME: case State.SCRIPT_DATA_ESCAPED_END_TAG_OPEN: case State.SCRIPT_DATA_ESCAPED_END_TAG_NAME: case State.CDATA_SECTION_END: return end - 2; case State.CHARACTER_REFERENCE: return this._isCharacterReferenceInAttribute() && tokenLocation ? tokenLocation.startOffset : this.preprocessor.droppedBufferSize + this.entityStartPos; case State.DOCTYPE: case State.BEFORE_DOCTYPE_NAME: return this.currentLocation.startOffset; default: if (tokenLocation && (this.state === State.TAG_NAME || this.state >= State.BEFORE_ATTRIBUTE_NAME && this.state <= State.BOGUS_COMMENT || this.state >= State.COMMENT_START && this.state <= State.BOGUS_DOCTYPE)) return tokenLocation.startOffset; return end; } } pause() { this.paused = true; } resume(writeCallback) { if (!this.paused) throw new Error("Parser was already resumed"); this.paused = false; if (this.inLoop) return; this._runParsingLoop(); if (!this.paused) writeCallback === null || writeCallback === void 0 || writeCallback(); } write(chunk, isLastChunk, writeCallback) { this.active = true; this.preprocessor.write(chunk, isLastChunk); this._runParsingLoop(); if (!this.paused) writeCallback === null || writeCallback === void 0 || writeCallback(); } insertHtmlAtCurrentPos(chunk) { this.active = true; this.preprocessor.insertHtmlAtCurrentPos(chunk); this._runParsingLoop(); } /** @internal Flush completed streaming text without splitting an unfinished token. */ flushCurrentCharacterToken() { if (this.paused || this.active || !this.currentCharacterToken || this.currentToken || this.state === State.DOCTYPE || this.state === State.BEFORE_DOCTYPE_NAME || !this.preprocessor.willDropParsedChunk()) return; const pending = this.preprocessor.droppedBufferSize + this.preprocessor.pos + 1 - this.getCharacterTokenEndOffset(); this.preprocessor.advance(); this.currentLocation = this.getCurrentLocation(pending); this.preprocessor.retreat(1); this._emitCurrentCharacterToken(this.currentLocation); this._createCharacterToken(TokenType.CHARACTER); this.preprocessor.dropParsedChunk(Math.max(pending - 1, 0)); this.entityStartPos = this.preprocessor.pos + 1 - pending; } _ensureHibernation() { if (this.preprocessor.endOfChunkHit) { this.preprocessor.retreat(this.consumedAfterSnapshot); this.consumedAfterSnapshot = 0; this.active = false; return true; } return false; } _consume() { this.consumedAfterSnapshot++; return this.preprocessor.advance(); } _advanceBy(count) { this.consumedAfterSnapshot += count; for (let i = 0; i < count; i++) this.preprocessor.advance(); } _consumeSequenceIfMatch(pattern, caseSensitive) { if (this.preprocessor.startsWith(pattern, caseSensitive)) { this._advanceBy(pattern.length - 1); return true; } return false; } _createStartTagToken() { this._flushRun(""); this.currentToken = { type: TokenType.START_TAG, tagName: "", tagID: TAG_ID.UNKNOWN, selfClosing: false, ackSelfClosing: false, attrs: [], location: this.getCurrentLocation(1) }; } _createEndTagToken() { this._flushRun(""); this.currentToken = { type: TokenType.END_TAG, tagName: "", tagID: TAG_ID.UNKNOWN, selfClosing: false, ackSelfClosing: false, attrs: [], location: this.getCurrentLocation(2) }; } _createCommentToken(offset) { this._flushRun(""); this.currentToken = { type: TokenType.COMMENT, data: "", location: this.getCurrentLocation(offset) }; } _createDoctypeToken(initialName) { this._flushRun(""); this.currentToken = { type: TokenType.DOCTYPE, name: initialName, forceQuirks: false, publicId: null, systemId: null, location: this.currentLocation }; } _createCharacterToken(type) { if (this.currentLocation) { const start = this.currentLocation.startOffset - this.preprocessor.droppedBufferSize; if (this.preprocessor.html[start] === "\n" && this.preprocessor.html[start - 1] === "\r") this.currentLocation.startOffset++; } this.currentCharacterToken = { type, chars: "", location: this.currentLocation }; } _createAttr(attrNameFirstCh) { this._flushRun(""); this.currentAttr = { name: attrNameFirstCh, value: "" }; this.currentAttrLocation = this.getCurrentLocation(0); } _leaveAttrName() { var _a; var _b; const token = this.currentToken; const { name } = this.currentAttr; const names = this.currentAttrNames; let duplicate; if (names === null) { duplicate = getTokenAttr(token, name) !== null; if (!duplicate && token.attrs.length === ATTR_NAME_SET_THRESHOLD) this.currentAttrNames = new Set(token.attrs.map((attr) => attr.name)).add(name); } else { duplicate = names.has(name); if (!duplicate) names.add(name); } if (duplicate) this._err(ERR.duplicateAttribute); else { token.attrs.push(this.currentAttr); if (token.location && this.currentAttrLocation) { const attrLocations = (_a = (_b = token.location).attrs) !== null && _a !== void 0 ? _a : _b.attrs = Object.create(null); attrLocations[this.currentAttr.name] = this.currentAttrLocation; this._leaveAttrValue(); } } } _leaveAttrValue() { if (this.currentAttrLocation) { this.currentAttrLocation.endLine = this.preprocessor.line; this.currentAttrLocation.endCol = this.preprocessor.col; this.currentAttrLocation.endOffset = this.preprocessor.offset; } } /** * Append the pending run and `text` to the attribute value, comment data or character token being built. * The run is a string of its own: V8 copies a slice of fewer than 13 characters but lets a longer one share * the input's buffer, which would keep that buffer alive for as long as any attribute value or text cut from * it is; a concatenation is flattened into a buffer of its own when it is sliced. */ _flushRun(text) { if (this.runEnd === this.runStart && text.length === 0) return; const slice = this.preprocessor.html.slice(this.runStart, this.runEnd); const run = (slice.length < 13 ? slice : ` ${slice}`.slice(1)) + text; const token = this.currentToken; this.runStart = this.runEnd; if (token === null) this.currentCharacterToken.chars += run; else if (token.type === TokenType.COMMENT) token.data += run; else this.currentAttr.value += run; } /** Extend the pending run by the current input code point, read as `cp`, or flush it and start a new one. */ _extendRun(cp) { const { preprocessor } = this; if (cp === CODE_POINTS.LINE_FEED && preprocessor.html.charCodeAt(preprocessor.pos) !== CODE_POINTS.LINE_FEED) { this._flushRun("\n"); this.runStart = preprocessor.pos + 1; } else { const start = preprocessor.pos - Number(cp > 65535); if (start !== this.runEnd) { this._flushRun(""); this.runStart = start; } } this.runEnd = preprocessor.pos + 1; } /** * Extend the pending run by `text`, the input that ends `cpOffset` code points after the current one, or flush * the run and append `text` where the input differs (a NUL replacement, a decoded reference, a dropped chunk). */ _extendRunWith(text, cpOffset) { const { preprocessor } = this; const start = preprocessor.codePointStart + 1 + cpOffset - text.length; if (start >= 0 && preprocessor.html.startsWith(text, start)) { if (start !== this.runEnd) { this._flushRun(""); this.runStart = start; } } else { this._flushRun(text); this.runStart = start + text.length; } this.runEnd = start + text.length; } prepareToken(ct) { this._emitCurrentCharacterToken(ct.location); this.currentToken = null; if (ct.location) { ct.location.endLine = this.preprocessor.line; ct.location.endCol = this.preprocessor.col + 1; ct.location.endOffset = this.preprocessor.offset + 1; } this.currentLocation = this.getCurrentLocation(-1); } emitCurrentTagToken() { const ct = this.currentToken; this.currentAttrNames = null; this.prepareToken(ct); ct.tagID = getTagID(ct.tagName); if (ct.type === TokenType.START_TAG) { this.lastStartTagName = ct.tagName; this.handler.onStartTag(ct); } else { if (ct.attrs.length > 0) this._err(ERR.endTagWithAttributes); if (ct.selfClosing) this._err(ERR.endTagWithTrailingSolidus); this.handler.onEndTag(ct); } this.preprocessor.dropParsedChunk(); } emitCurrentComment(ct) { this.prepareToken(ct); this.handler.onComment(ct); this.preprocessor.dropParsedChunk(); } emitCurrentDoctype(ct) { this.prepareToken(ct); this.handler.onDoctype(ct); this.preprocessor.dropParsedChunk(); } _emitCurrentCharacterToken(nextLocation) { this._flushRun(""); if (this.currentCharacterToken) { if (nextLocation && this.currentCharacterToken.location) { this.currentCharacterToken.location.endLine = nextLocation.startLine; this.currentCharacterToken.location.endCol = nextLocation.startCol; this.currentCharacterToken.location.endOffset = nextLocation.startOffset; } switch (this.currentCharacterToken.type) { case TokenType.CHARACTER: this.handler.onCharacter(this.currentCharacterToken); break; case TokenType.NULL_CHARACTER: this.handler.onNullCharacter(this.currentCharacterToken); break; case TokenType.WHITESPACE_CHARACTER: this.handler.onWhitespaceCharacter(this.currentCharacterToken); } this.currentCharacterToken = null; } } _emitEOFToken() { var _a, _b; const location = this.getCurrentLocation(0); if (location) { location.endLine = location.startLine; location.endCol = location.startCol; location.endOffset = location.startOffset; } this._emitCurrentCharacterToken((_b = (_a = this.currentToken) === null || _a === void 0 ? void 0 : _a.location) !== null && _b !== void 0 ? _b : location); this.handler.onEof({ type: TokenType.EOF, location }); this.active = false; } /** Make the current character token one of `type`, emitting the current one if it has another type. */ _ensureCharacterToken(type) { if (this.currentCharacterToken) { if (this.currentCharacterToken.type === type) return; this.currentLocation = this.getCurrentLocation(0); this._emitCurrentCharacterToken(this.currentLocation); this.preprocessor.dropParsedChunk(); } this._createCharacterToken(type); } /** Emit the current input code point, read as `cp`. */ _emitCodePoint(cp) { const type = isWhitespace(cp) ? TokenType.WHITESPACE_CHARACTER : cp === CODE_POINTS.NULL ? TokenType.NULL_CHARACTER : TokenType.CHARACTER; const token = this.currentCharacterToken; if (token === null || token.type !== type) this._ensureCharacterToken(type); this._extendRun(cp); } _emitChars(ch, cpOffset = 0) { if (this.options.sourceCodeLocationInfo && cpOffset !== 0 && this.currentCharacterToken && this.currentCharacterToken.type !== TokenType.CHARACTER) { this.currentLocation = this.getCurrentLocation(ch.length - 1 - cpOffset); this._emitCurrentCharacterToken(this.currentLocation); this._createCharacterToken(TokenType.CHARACTER); } else this._ensureCharacterToken(TokenType.CHARACTER); this._extendRunWith(ch, cpOffset); } _startCharacterReference() { this.returnState = this.state; this.state = State.CHARACTER_REFERENCE; this.entityStartPos = this.preprocessor.pos; this.entityDecoder.startEntity(this._isCharacterReferenceInAttribute() ? DecodingMode.Attribute : DecodingMode.Legacy); } _isCharacterReferenceInAttribute() { return this.returnState === State.ATTRIBUTE_VALUE_DOUBLE_QUOTED || this.returnState === State.ATTRIBUTE_VALUE_SINGLE_QUOTED || this.returnState === State.ATTRIBUTE_VALUE_UNQUOTED; } _flushCodePointConsumedAsCharacterReference(cp) { if (this._isCharacterReferenceInAttribute()) this._extendRun(cp); else this._emitCodePoint(cp); } _callState(cp) { switch (this.state) { case State.DATA: this._stateData(cp); break; case State.RCDATA: this._stateRcdata(cp); break; case State.RAWTEXT: this._stateRawtext(cp); break; case State.SCRIPT_DATA: this._stateScriptData(cp); break; case State.PLAINTEXT: this._statePlaintext(cp); break; case State.TAG_OPEN: this._stateTagOpen(cp); break; case State.END_TAG_OPEN: this._stateEndTagOpen(cp); break; case State.TAG_NAME: this._stateTagName(cp); break; case State.RCDATA_LESS_THAN_SIGN: this._stateRcdataLessThanSign(cp); break; case State.RCDATA_END_TAG_OPEN: this._stateRcdataEndTagOpen(cp); break; case State.RCDATA_END_TAG_NAME: this._stateRcdataEndTagName(cp); break; case State.RAWTEXT_LESS_THAN_SIGN: this._stateRawtextLessThanSign(cp); break; case State.RAWTEXT_END_TAG_OPEN: this._stateRawtextEndTagOpen(cp); break; case State.RAWTEXT_END_TAG_NAME: this._stateRawtextEndTagName(cp); break; case State.SCRIPT_DATA_LESS_THAN_SIGN: this._stateScriptDataLessThanSign(cp); break; case State.SCRIPT_DATA_END_TAG_OPEN: this._stateScriptDataEndTagOpen(cp); break; case State.SCRIPT_DATA_END_TAG_NAME: this._stateScriptDataEndTagName(cp); break; case State.SCRIPT_DATA_ESCAPE_START: this._stateScriptDataEscapeStart(cp); break; case State.SCRIPT_DATA_ESCAPE_START_DASH: this._stateScriptDataEscapeStartDash(cp); break; case State.SCRIPT_DATA_ESCAPED: this._stateScriptDataEscaped(cp); break; case State.SCRIPT_DATA_ESCAPED_DASH: this._stateScriptDataEscapedDash(cp); break; case State.SCRIPT_DATA_ESCAPED_DASH_DASH: this._stateScriptDataEscapedDashDash(cp); break; case State.SCRIPT_DATA_ESCAPED_LESS_THAN_SIGN: this._stateScriptDataEscapedLessThanSign(cp); break; case State.SCRIPT_DATA_ESCAPED_END_TAG_OPEN: this._stateScriptDataEscapedEndTagOpen(cp); break; case State.SCRIPT_DATA_ESCAPED_END_TAG_NAME: this._stateScriptDataEscapedEndTagName(cp); break; case State.SCRIPT_DATA_DOUBLE_ESCAPE_START: this._stateScriptDataDoubleEscapeStart(cp); break; case State.SCRIPT_DATA_DOUBLE_ESCAPED: this._stateScriptDataDoubleEscaped(cp); break; case State.SCRIPT_DATA_DOUBLE_ESCAPED_DASH: this._stateScriptDataDoubleEscapedDash(cp); break; case State.SCRIPT_DATA_DOUBLE_ESCAPED_DASH_DASH: this._stateScriptDataDoubleEscapedDashDash(cp); break; case State.SCRIPT_DATA_DOUBLE_ESCAPED_LESS_THAN_SIGN: this._stateScriptDataDoubleEscapedLessThanSign(cp); break; case State.SCRIPT_DATA_DOUBLE_ESCAPE_END: this._stateScriptDataDoubleEscapeEnd(cp); break; case State.BEFORE_ATTRIBUTE_NAME: this._stateBeforeAttributeName(cp); break; case State.ATTRIBUTE_NAME: this._stateAttributeName(cp); break; case State.AFTER_ATTRIBUTE_NAME: this._stateAfterAttributeName(cp); break; case State.BEFORE_ATTRIBUTE_VALUE: this._stateBeforeAttributeValue(cp); break; case State.ATTRIBUTE_VALUE_DOUBLE_QUOTED: this._stateAttributeValueDoubleQuoted(cp); break; case State.ATTRIBUTE_VALUE_SINGLE_QUOTED: this._stateAttributeValueSingleQuoted(cp); break; case State.ATTRIBUTE_VALUE_UNQUOTED: this._stateAttributeValueUnquoted(cp); break; case State.AFTER_ATTRIBUTE_VALUE_QUOTED: this._stateAfterAttributeValueQuoted(cp); break; case State.SELF_CLOSING_START_TAG: this._stateSelfClosingStartTag(cp); break; case State.BOGUS_COMMENT: this._stateBogusComment(cp); break; case State.MARKUP_DECLARATION_OPEN: this._stateMarkupDeclarationOpen(cp); break; case State.COMMENT_START: this._stateCommentStart(cp); break; case State.COMMENT_START_DASH: this._stateCommentStartDash(cp); break; case State.COMMENT: this._stateComment(cp); break; case State.COMMENT_LESS_THAN_SIGN: this._stateCommentLessThanSign(cp); break; case State.COMMENT_LESS_THAN_SIGN_BANG: this._stateCommentLessThanSignBang(cp); break; case State.COMMENT_LESS_THAN_SIGN_BANG_DASH: this._stateCommentLessThanSignBangDash(cp); break; case State.COMMENT_LESS_THAN_SIGN_BANG_DASH_DASH: this._stateCommentLessThanSignBangDashDash(cp); break; case State.COMMENT_END_DASH: this._stateCommentEndDash(cp); break; case State.COMMENT_END: this._stateCommentEnd(cp); break; case State.COMMENT_END_BANG: this._stateCommentEndBang(cp); break; case State.DOCTYPE: this._stateDoctype(cp); break; case State.BEFORE_DOCTYPE_NAME: this._stateBeforeDoctypeName(cp); break; case State.DOCTYPE_NAME: this._stateDoctypeName(cp); break; case State.AFTER_DOCTYPE_NAME: this._stateAfterDoctypeName(cp); break; case State.AFTER_DOCTYPE_PUBLIC_KEYWORD: this._stateAfterDoctypePublicKeyword(cp); break; case State.BEFORE_DOCTYPE_PUBLIC_IDENTIFIER: this._stateBeforeDoctypePublicIdentifier(cp); break; case State.DOCTYPE_PUBLIC_IDENTIFIER_DOUBLE_QUOTED: this._stateDoctypePublicIdentifierDoubleQuoted(cp); break; case State.DOCTYPE_PUBLIC_IDENTIFIER_SINGLE_QUOTED: this._stateDoctypePublicIdentifierSingleQuoted(cp); break; case State.AFTER_DOCTYPE_PUBLIC_IDENTIFIER: this._stateAfterDoctypePublicIdentifier(cp); break; case State.BETWEEN_DOCTYPE_PUBLIC_AND_SYSTEM_IDENTIFIERS: this._stateBetweenDoctypePublicAndSystemIdentifiers(cp); break; case State.AFTER_DOCTYPE_SYSTEM_KEYWORD: this._stateAfterDoctypeSystemKeyword(cp); break; case State.BEFORE_DOCTYPE_SYSTEM_IDENTIFIER: this._stateBeforeDoctypeSystemIdentifier(cp); break; case State.DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED: this._stateDoctypeSystemIdentifierDoubleQuoted(cp); break; case State.DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED: this._stateDoctypeSystemIdentifierSingleQuoted(cp); break; case State.AFTER_DOCTYPE_SYSTEM_IDENTIFIER: this._stateAfterDoctypeSystemIdentifier(cp); break; case State.BOGUS_DOCTYPE: this._stateBogusDoctype(cp); break; case State.CDATA_SECTION: this._stateCdataSection(cp); break; case State.CDATA_SECTION_BRACKET: this._stateCdataSectionBracket(cp); break; case State.CDATA_SECTION_END: this._stateCdataSectionEnd(cp); break; case State.CHARACTER_REFERENCE: this._stateCharacterReference(); break; case State.AMBIGUOUS_AMPERSAND: this._stateAmbiguousAmpersand(cp); break; default: throw new Error("Unknown state"); } } _stateData(cp) { switch (cp) { case CODE_POINTS.LESS_THAN_SIGN: this.state = State.TAG_OPEN; break; case CODE_POINTS.AMPERSAND: this._startCharacterReference(); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._emitCodePoint(cp); break; case CODE_POINTS.EOF: this._emitEOFToken(); break; default: this._emitCodePoint(cp); } } _stateRcdata(cp) { switch (cp) { case CODE_POINTS.AMPERSAND: this._startCharacterReference(); break; case CODE_POINTS.LESS_THAN_SIGN: this.state = State.RCDATA_LESS_THAN_SIGN; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._emitChars("�"); break; case CODE_POINTS.EOF: this._emitEOFToken(); break; default: this._emitCodePoint(cp); } } _stateRawtext(cp) { switch (cp) { case CODE_POINTS.LESS_THAN_SIGN: this.state = State.RAWTEXT_LESS_THAN_SIGN; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._emitChars("�"); break; case CODE_POINTS.EOF: this._emitEOFToken(); break; default: this._emitCodePoint(cp); } } _stateScriptData(cp) { switch (cp) { case CODE_POINTS.LESS_THAN_SIGN: this.state = State.SCRIPT_DATA_LESS_THAN_SIGN; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._emitChars("�"); break; case CODE_POINTS.EOF: this._emitEOFToken(); break; default: this._emitCodePoint(cp); } } _statePlaintext(cp) { switch (cp) { case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._emitChars("�"); break; case CODE_POINTS.EOF: this._emitEOFToken(); break; default: this._emitCodePoint(cp); } } _stateTagOpen(cp) { if (isAsciiLetter(cp)) { this._createStartTagToken(); this.state = State.TAG_NAME; this._stateTagName(cp); } else switch (cp) { case CODE_POINTS.EXCLAMATION_MARK: this.state = State.MARKUP_DECLARATION_OPEN; break; case CODE_POINTS.SOLIDUS: this.state = State.END_TAG_OPEN; break; case CODE_POINTS.QUESTION_MARK: this._err(ERR.unexpectedQuestionMarkInsteadOfTagName); this._createCommentToken(1); this.state = State.BOGUS_COMMENT; this._stateBogusComment(cp); break; case CODE_POINTS.EOF: this._err(ERR.eofBeforeTagName); this._emitChars("<", -1); this._emitEOFToken(); break; default: this._err(ERR.invalidFirstCharacterOfTagName); this._emitChars("<", -1); this.state = State.DATA; this._stateData(cp); } } _stateEndTagOpen(cp) { if (isAsciiLetter(cp)) { this._createEndTagToken(); this.state = State.TAG_NAME; this._stateTagName(cp); } else switch (cp) { case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.missingEndTagName); this.state = State.DATA; break; case CODE_POINTS.EOF: this._err(ERR.eofBeforeTagName); this._emitChars(""); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this.state = State.SCRIPT_DATA_ESCAPED; this._emitChars("�"); break; case CODE_POINTS.EOF: this._err(ERR.eofInScriptHtmlCommentLikeText); this._emitEOFToken(); break; default: this.state = State.SCRIPT_DATA_ESCAPED; this._emitCodePoint(cp); } } _stateScriptDataEscapedLessThanSign(cp) { if (cp === CODE_POINTS.SOLIDUS) this.state = State.SCRIPT_DATA_ESCAPED_END_TAG_OPEN; else if (isAsciiLetter(cp)) { this._emitChars("<", -1); this.state = State.SCRIPT_DATA_DOUBLE_ESCAPE_START; this._stateScriptDataDoubleEscapeStart(cp); } else { this._emitChars("<", -1); this.state = State.SCRIPT_DATA_ESCAPED; this._stateScriptDataEscaped(cp); } } _stateScriptDataEscapedEndTagOpen(cp) { if (isAsciiLetter(cp)) { this.state = State.SCRIPT_DATA_ESCAPED_END_TAG_NAME; this._stateScriptDataEscapedEndTagName(cp); } else { this._emitChars(""); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this.state = State.SCRIPT_DATA_DOUBLE_ESCAPED; this._emitChars("�"); break; case CODE_POINTS.EOF: this._err(ERR.eofInScriptHtmlCommentLikeText); this._emitEOFToken(); break; default: this.state = State.SCRIPT_DATA_DOUBLE_ESCAPED; this._emitCodePoint(cp); } } _stateScriptDataDoubleEscapedLessThanSign(cp) { if (cp === CODE_POINTS.SOLIDUS) { this.state = State.SCRIPT_DATA_DOUBLE_ESCAPE_END; this._emitChars("/"); } else { this.state = State.SCRIPT_DATA_DOUBLE_ESCAPED; this._stateScriptDataDoubleEscaped(cp); } } _stateScriptDataDoubleEscapeEnd(cp) { if (this.preprocessor.startsWith(SEQUENCES.SCRIPT, false) && isScriptDataDoubleEscapeSequenceEnd(this.preprocessor.peek(SEQUENCES.SCRIPT.length))) { this._emitCodePoint(cp); for (let i = 0; i < SEQUENCES.SCRIPT.length; i++) this._emitCodePoint(this._consume()); this.state = State.SCRIPT_DATA_ESCAPED; } else if (!this._ensureHibernation()) { this.state = State.SCRIPT_DATA_DOUBLE_ESCAPED; this._stateScriptDataDoubleEscaped(cp); } } _stateBeforeAttributeName(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.SOLIDUS: case CODE_POINTS.GREATER_THAN_SIGN: case CODE_POINTS.EOF: this.state = State.AFTER_ATTRIBUTE_NAME; this._stateAfterAttributeName(cp); break; case CODE_POINTS.EQUALS_SIGN: this._err(ERR.unexpectedEqualsSignBeforeAttributeName); this._createAttr("="); this.state = State.ATTRIBUTE_NAME; break; default: this._createAttr(""); this.state = State.ATTRIBUTE_NAME; this._stateAttributeName(cp); } } _stateAttributeName(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: case CODE_POINTS.SOLIDUS: case CODE_POINTS.GREATER_THAN_SIGN: case CODE_POINTS.EOF: this._leaveAttrName(); this.state = State.AFTER_ATTRIBUTE_NAME; this._stateAfterAttributeName(cp); break; case CODE_POINTS.EQUALS_SIGN: this._leaveAttrName(); this.state = State.BEFORE_ATTRIBUTE_VALUE; break; case CODE_POINTS.QUOTATION_MARK: case CODE_POINTS.APOSTROPHE: case CODE_POINTS.LESS_THAN_SIGN: this._err(ERR.unexpectedCharacterInAttributeName); this.currentAttr.name += String.fromCodePoint(cp); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this.currentAttr.name += "�"; break; default: this.currentAttr.name += String.fromCodePoint(isAsciiUpper(cp) ? toAsciiLower(cp) : cp); } } _stateAfterAttributeName(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.SOLIDUS: this.state = State.SELF_CLOSING_START_TAG; break; case CODE_POINTS.EQUALS_SIGN: this.state = State.BEFORE_ATTRIBUTE_VALUE; break; case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; this.emitCurrentTagToken(); break; case CODE_POINTS.EOF: this._err(ERR.eofInTag); this._emitEOFToken(); break; default: this._createAttr(""); this.state = State.ATTRIBUTE_NAME; this._stateAttributeName(cp); } } _stateBeforeAttributeValue(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.QUOTATION_MARK: this.state = State.ATTRIBUTE_VALUE_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: this.state = State.ATTRIBUTE_VALUE_SINGLE_QUOTED; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.missingAttributeValue); this.state = State.DATA; this.emitCurrentTagToken(); break; default: this.state = State.ATTRIBUTE_VALUE_UNQUOTED; this._stateAttributeValueUnquoted(cp); } } _stateAttributeValueDoubleQuoted(cp) { switch (cp) { case CODE_POINTS.QUOTATION_MARK: this.state = State.AFTER_ATTRIBUTE_VALUE_QUOTED; break; case CODE_POINTS.AMPERSAND: this._startCharacterReference(); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._extendRunWith("�", 0); break; case CODE_POINTS.EOF: this._err(ERR.eofInTag); this._emitEOFToken(); break; default: this._extendRun(cp); } } _stateAttributeValueSingleQuoted(cp) { switch (cp) { case CODE_POINTS.APOSTROPHE: this.state = State.AFTER_ATTRIBUTE_VALUE_QUOTED; break; case CODE_POINTS.AMPERSAND: this._startCharacterReference(); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._extendRunWith("�", 0); break; case CODE_POINTS.EOF: this._err(ERR.eofInTag); this._emitEOFToken(); break; default: this._extendRun(cp); } } _stateAttributeValueUnquoted(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this._leaveAttrValue(); this.state = State.BEFORE_ATTRIBUTE_NAME; break; case CODE_POINTS.AMPERSAND: this._startCharacterReference(); break; case CODE_POINTS.GREATER_THAN_SIGN: this._leaveAttrValue(); this.state = State.DATA; this.emitCurrentTagToken(); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._extendRunWith("�", 0); break; case CODE_POINTS.QUOTATION_MARK: case CODE_POINTS.APOSTROPHE: case CODE_POINTS.LESS_THAN_SIGN: case CODE_POINTS.EQUALS_SIGN: case CODE_POINTS.GRAVE_ACCENT: this._err(ERR.unexpectedCharacterInUnquotedAttributeValue); this._extendRun(cp); break; case CODE_POINTS.EOF: this._err(ERR.eofInTag); this._emitEOFToken(); break; default: this._extendRun(cp); } } _stateAfterAttributeValueQuoted(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this._leaveAttrValue(); this.state = State.BEFORE_ATTRIBUTE_NAME; break; case CODE_POINTS.SOLIDUS: this._leaveAttrValue(); this.state = State.SELF_CLOSING_START_TAG; break; case CODE_POINTS.GREATER_THAN_SIGN: this._leaveAttrValue(); this.state = State.DATA; this.emitCurrentTagToken(); break; case CODE_POINTS.EOF: this._err(ERR.eofInTag); this._emitEOFToken(); break; default: this._err(ERR.missingWhitespaceBetweenAttributes); this._leaveAttrValue(); this.state = State.BEFORE_ATTRIBUTE_NAME; this._stateBeforeAttributeName(cp); } } _stateSelfClosingStartTag(cp) { switch (cp) { case CODE_POINTS.GREATER_THAN_SIGN: { const token = this.currentToken; token.selfClosing = true; this.state = State.DATA; this.emitCurrentTagToken(); break; } case CODE_POINTS.EOF: this._err(ERR.eofInTag); this._emitEOFToken(); break; default: this._err(ERR.unexpectedSolidusInTag); this.state = State.BEFORE_ATTRIBUTE_NAME; this._stateBeforeAttributeName(cp); } } _stateBogusComment(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; this.emitCurrentComment(token); break; case CODE_POINTS.EOF: this.emitCurrentComment(token); this._emitEOFToken(); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._extendRunWith("�", 0); break; default: this._extendRun(cp); } } _stateMarkupDeclarationOpen(cp) { if (this._consumeSequenceIfMatch(SEQUENCES.DASH_DASH, true)) { this._createCommentToken(SEQUENCES.DASH_DASH.length + 1); this.state = State.COMMENT_START; } else if (this._consumeSequenceIfMatch(SEQUENCES.DOCTYPE, false)) { this.currentLocation = this.getCurrentLocation(SEQUENCES.DOCTYPE.length + 1); this.state = State.DOCTYPE; } else if (this._consumeSequenceIfMatch(SEQUENCES.CDATA_START, true)) { if (this.inForeignNode) this.state = State.CDATA_SECTION; else { this._err(ERR.cdataInHtmlContent); this._createCommentToken(SEQUENCES.CDATA_START.length + 1); this.currentToken.data = "[CDATA["; this.state = State.BOGUS_COMMENT; } } else if (!this._ensureHibernation()) { this._err(ERR.incorrectlyOpenedComment); this._createCommentToken(2); this.state = State.BOGUS_COMMENT; this._stateBogusComment(cp); } } _stateCommentStart(cp) { switch (cp) { case CODE_POINTS.HYPHEN_MINUS: this.state = State.COMMENT_START_DASH; break; case CODE_POINTS.GREATER_THAN_SIGN: { this._err(ERR.abruptClosingOfEmptyComment); this.state = State.DATA; const token = this.currentToken; this.emitCurrentComment(token); break; } default: this.state = State.COMMENT; this._stateComment(cp); } } _stateCommentStartDash(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.HYPHEN_MINUS: this.state = State.COMMENT_END; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.abruptClosingOfEmptyComment); this.state = State.DATA; this.emitCurrentComment(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInComment); this.emitCurrentComment(token); this._emitEOFToken(); break; default: this._extendRunWith("-", -1); this.state = State.COMMENT; this._stateComment(cp); } } _stateComment(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.HYPHEN_MINUS: this.state = State.COMMENT_END_DASH; break; case CODE_POINTS.LESS_THAN_SIGN: this._extendRunWith("<", 0); this.state = State.COMMENT_LESS_THAN_SIGN; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._extendRunWith("�", 0); break; case CODE_POINTS.EOF: this._err(ERR.eofInComment); this.emitCurrentComment(token); this._emitEOFToken(); break; default: this._extendRun(cp); } } _stateCommentLessThanSign(cp) { switch (cp) { case CODE_POINTS.EXCLAMATION_MARK: this._extendRunWith("!", 0); this.state = State.COMMENT_LESS_THAN_SIGN_BANG; break; case CODE_POINTS.LESS_THAN_SIGN: this._extendRunWith("<", 0); break; default: this.state = State.COMMENT; this._stateComment(cp); } } _stateCommentLessThanSignBang(cp) { if (cp === CODE_POINTS.HYPHEN_MINUS) this.state = State.COMMENT_LESS_THAN_SIGN_BANG_DASH; else { this.state = State.COMMENT; this._stateComment(cp); } } _stateCommentLessThanSignBangDash(cp) { if (cp === CODE_POINTS.HYPHEN_MINUS) this.state = State.COMMENT_LESS_THAN_SIGN_BANG_DASH_DASH; else { this.state = State.COMMENT_END_DASH; this._stateCommentEndDash(cp); } } _stateCommentLessThanSignBangDashDash(cp) { if (cp !== CODE_POINTS.GREATER_THAN_SIGN && cp !== CODE_POINTS.EOF) this._err(ERR.nestedComment); this.state = State.COMMENT_END; this._stateCommentEnd(cp); } _stateCommentEndDash(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.HYPHEN_MINUS: this.state = State.COMMENT_END; break; case CODE_POINTS.EOF: this._err(ERR.eofInComment); this.emitCurrentComment(token); this._emitEOFToken(); break; default: this._extendRunWith("-", -1); this.state = State.COMMENT; this._stateComment(cp); } } _stateCommentEnd(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; this.emitCurrentComment(token); break; case CODE_POINTS.EXCLAMATION_MARK: this.state = State.COMMENT_END_BANG; break; case CODE_POINTS.HYPHEN_MINUS: this._extendRunWith("-", -2); break; case CODE_POINTS.EOF: this._err(ERR.eofInComment); this.emitCurrentComment(token); this._emitEOFToken(); break; default: this._extendRunWith("--", -1); this.state = State.COMMENT; this._stateComment(cp); } } _stateCommentEndBang(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.HYPHEN_MINUS: this._extendRunWith("--!", -1); this.state = State.COMMENT_END_DASH; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.incorrectlyClosedComment); this.state = State.DATA; this.emitCurrentComment(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInComment); this.emitCurrentComment(token); this._emitEOFToken(); break; default: this._extendRunWith("--!", -1); this.state = State.COMMENT; this._stateComment(cp); } } _stateDoctype(cp) { switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this.state = State.BEFORE_DOCTYPE_NAME; break; case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.BEFORE_DOCTYPE_NAME; this._stateBeforeDoctypeName(cp); break; case CODE_POINTS.EOF: { this._err(ERR.eofInDoctype); this._createDoctypeToken(null); const token = this.currentToken; token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; } default: this._err(ERR.missingWhitespaceBeforeDoctypeName); this.state = State.BEFORE_DOCTYPE_NAME; this._stateBeforeDoctypeName(cp); } } _stateBeforeDoctypeName(cp) { if (isAsciiUpper(cp)) { this._createDoctypeToken(String.fromCharCode(toAsciiLower(cp))); this.state = State.DOCTYPE_NAME; } else switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); this._createDoctypeToken("�"); this.state = State.DOCTYPE_NAME; break; case CODE_POINTS.GREATER_THAN_SIGN: { this._err(ERR.missingDoctypeName); this._createDoctypeToken(null); const token = this.currentToken; token.forceQuirks = true; this.emitCurrentDoctype(token); this.state = State.DATA; break; } case CODE_POINTS.EOF: { this._err(ERR.eofInDoctype); this._createDoctypeToken(null); const token = this.currentToken; token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; } default: this._createDoctypeToken(String.fromCodePoint(cp)); this.state = State.DOCTYPE_NAME; } } _stateDoctypeName(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this.state = State.AFTER_DOCTYPE_NAME; break; case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); token.name += "�"; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: token.name += String.fromCodePoint(isAsciiUpper(cp) ? toAsciiLower(cp) : cp); } } _stateAfterDoctypeName(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: if (this._consumeSequenceIfMatch(SEQUENCES.PUBLIC, false)) this.state = State.AFTER_DOCTYPE_PUBLIC_KEYWORD; else if (this._consumeSequenceIfMatch(SEQUENCES.SYSTEM, false)) this.state = State.AFTER_DOCTYPE_SYSTEM_KEYWORD; else if (!this._ensureHibernation()) { this._err(ERR.invalidCharacterSequenceAfterDoctypeName); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } } _stateAfterDoctypePublicKeyword(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this.state = State.BEFORE_DOCTYPE_PUBLIC_IDENTIFIER; break; case CODE_POINTS.QUOTATION_MARK: this._err(ERR.missingWhitespaceAfterDoctypePublicKeyword); token.publicId = ""; this.state = State.DOCTYPE_PUBLIC_IDENTIFIER_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: this._err(ERR.missingWhitespaceAfterDoctypePublicKeyword); token.publicId = ""; this.state = State.DOCTYPE_PUBLIC_IDENTIFIER_SINGLE_QUOTED; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.missingDoctypePublicIdentifier); token.forceQuirks = true; this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.missingQuoteBeforeDoctypePublicIdentifier); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateBeforeDoctypePublicIdentifier(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.QUOTATION_MARK: token.publicId = ""; this.state = State.DOCTYPE_PUBLIC_IDENTIFIER_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: token.publicId = ""; this.state = State.DOCTYPE_PUBLIC_IDENTIFIER_SINGLE_QUOTED; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.missingDoctypePublicIdentifier); token.forceQuirks = true; this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.missingQuoteBeforeDoctypePublicIdentifier); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateDoctypePublicIdentifierDoubleQuoted(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.QUOTATION_MARK: this.state = State.AFTER_DOCTYPE_PUBLIC_IDENTIFIER; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); token.publicId += "�"; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.abruptDoctypePublicIdentifier); token.forceQuirks = true; this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: token.publicId += String.fromCodePoint(cp); } } _stateDoctypePublicIdentifierSingleQuoted(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.APOSTROPHE: this.state = State.AFTER_DOCTYPE_PUBLIC_IDENTIFIER; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); token.publicId += "�"; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.abruptDoctypePublicIdentifier); token.forceQuirks = true; this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: token.publicId += String.fromCodePoint(cp); } } _stateAfterDoctypePublicIdentifier(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this.state = State.BETWEEN_DOCTYPE_PUBLIC_AND_SYSTEM_IDENTIFIERS; break; case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.QUOTATION_MARK: this._err(ERR.missingWhitespaceBetweenDoctypePublicAndSystemIdentifiers); token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: this._err(ERR.missingWhitespaceBetweenDoctypePublicAndSystemIdentifiers); token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.missingQuoteBeforeDoctypeSystemIdentifier); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateBetweenDoctypePublicAndSystemIdentifiers(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.GREATER_THAN_SIGN: this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.QUOTATION_MARK: token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.missingQuoteBeforeDoctypeSystemIdentifier); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateAfterDoctypeSystemKeyword(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: this.state = State.BEFORE_DOCTYPE_SYSTEM_IDENTIFIER; break; case CODE_POINTS.QUOTATION_MARK: this._err(ERR.missingWhitespaceAfterDoctypeSystemKeyword); token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: this._err(ERR.missingWhitespaceAfterDoctypeSystemKeyword); token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.missingDoctypeSystemIdentifier); token.forceQuirks = true; this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.missingQuoteBeforeDoctypeSystemIdentifier); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateBeforeDoctypeSystemIdentifier(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.QUOTATION_MARK: token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_DOUBLE_QUOTED; break; case CODE_POINTS.APOSTROPHE: token.systemId = ""; this.state = State.DOCTYPE_SYSTEM_IDENTIFIER_SINGLE_QUOTED; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.missingDoctypeSystemIdentifier); token.forceQuirks = true; this.state = State.DATA; this.emitCurrentDoctype(token); break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.missingQuoteBeforeDoctypeSystemIdentifier); token.forceQuirks = true; this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateDoctypeSystemIdentifierDoubleQuoted(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.QUOTATION_MARK: this.state = State.AFTER_DOCTYPE_SYSTEM_IDENTIFIER; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); token.systemId += "�"; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.abruptDoctypeSystemIdentifier); token.forceQuirks = true; this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: token.systemId += String.fromCodePoint(cp); } } _stateDoctypeSystemIdentifierSingleQuoted(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.APOSTROPHE: this.state = State.AFTER_DOCTYPE_SYSTEM_IDENTIFIER; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); token.systemId += "�"; break; case CODE_POINTS.GREATER_THAN_SIGN: this._err(ERR.abruptDoctypeSystemIdentifier); token.forceQuirks = true; this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: token.systemId += String.fromCodePoint(cp); } } _stateAfterDoctypeSystemIdentifier(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.SPACE: case CODE_POINTS.LINE_FEED: case CODE_POINTS.TABULATION: case CODE_POINTS.FORM_FEED: break; case CODE_POINTS.GREATER_THAN_SIGN: this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.EOF: this._err(ERR.eofInDoctype); token.forceQuirks = true; this.emitCurrentDoctype(token); this._emitEOFToken(); break; default: this._err(ERR.unexpectedCharacterAfterDoctypeSystemIdentifier); this.state = State.BOGUS_DOCTYPE; this._stateBogusDoctype(cp); } } _stateBogusDoctype(cp) { const token = this.currentToken; switch (cp) { case CODE_POINTS.GREATER_THAN_SIGN: this.emitCurrentDoctype(token); this.state = State.DATA; break; case CODE_POINTS.NULL: this._err(ERR.unexpectedNullCharacter); break; case CODE_POINTS.EOF: this.emitCurrentDoctype(token); this._emitEOFToken(); } } _stateCdataSection(cp) { switch (cp) { case CODE_POINTS.RIGHT_SQUARE_BRACKET: this.state = State.CDATA_SECTION_BRACKET; break; case CODE_POINTS.EOF: this._err(ERR.eofInCdata); this._emitEOFToken(); break; default: this._emitCodePoint(cp); } } _stateCdataSectionBracket(cp) { if (cp === CODE_POINTS.RIGHT_SQUARE_BRACKET) this.state = State.CDATA_SECTION_END; else { this._emitChars("]", -1); this.state = State.CDATA_SECTION; this._stateCdataSection(cp); } } _stateCdataSectionEnd(cp) { switch (cp) { case CODE_POINTS.GREATER_THAN_SIGN: this.state = State.DATA; break; case CODE_POINTS.RIGHT_SQUARE_BRACKET: this._emitChars("]", -2); break; default: this._emitChars("]]", -1); this.state = State.CDATA_SECTION; this._stateCdataSection(cp); } } _stateCharacterReference() { let length = this.entityDecoder.write(this.preprocessor.html, this.preprocessor.pos); if (length < 0) { if (this.preprocessor.lastChunkWritten) length = this.entityDecoder.end(); else { this.active = false; this.preprocessor.pos = this.preprocessor.html.length - 1; this.consumedAfterSnapshot = 0; this.preprocessor.endOfChunkHit = true; return; } } if (length === 0) { this.preprocessor.pos = this.entityStartPos; this._flushCodePointConsumedAsCharacterReference(CODE_POINTS.AMPERSAND); this.state = !this._isCharacterReferenceInAttribute() && isAsciiAlphaNumeric(this.preprocessor.peek(1)) ? State.AMBIGUOUS_AMPERSAND : this.returnState; } else this.state = this.returnState; } _stateAmbiguousAmpersand(cp) { if (isAsciiAlphaNumeric(cp)) this._flushCodePointConsumedAsCharacterReference(cp); else { if (cp === CODE_POINTS.SEMICOLON) this._err(ERR.unknownNamedCharacterReference); this.state = this.returnState; this._callState(cp); } } }; // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/parser/open-element-stack.js const IMPLICIT_END_TAG_REQUIRED = /* @__PURE__ */ new Set([ TAG_ID.DD, TAG_ID.DT, TAG_ID.LI, TAG_ID.OPTGROUP, TAG_ID.OPTION, TAG_ID.P, TAG_ID.RB, TAG_ID.RP, TAG_ID.RT, TAG_ID.RTC ]); const IMPLICIT_END_TAG_REQUIRED_THOROUGHLY = /* @__PURE__ */ new Set([ ...IMPLICIT_END_TAG_REQUIRED, TAG_ID.CAPTION, TAG_ID.COLGROUP, TAG_ID.TBODY, TAG_ID.TD, TAG_ID.TFOOT, TAG_ID.TH, TAG_ID.THEAD, TAG_ID.TR ]); /** A stack this deep starts to index its elements; a shallower one is cheaper to scan than to index. */ const INDEX_DEPTH = 64; const SVG_KEYS = 256; const MATHML_KEYS = 512; const NAME_KEYS = 768; const NUMBERED_HEADERS = [ TAG_ID.H1, TAG_ID.H2, TAG_ID.H3, TAG_ID.H4, TAG_ID.H5, TAG_ID.H6 ]; const TABLE_BODIES = [ TAG_ID.TBODY, TAG_ID.TFOOT, TAG_ID.THEAD ]; const TABLE_ROW_CONTEXT = [ TAG_ID.TR, TAG_ID.TEMPLATE, TAG_ID.HTML ]; const TABLE_BODY_CONTEXT = [ ...TABLE_BODIES, TAG_ID.TEMPLATE, TAG_ID.HTML ]; const TABLE_CONTEXT = [ TAG_ID.TABLE, TAG_ID.TEMPLATE, TAG_ID.HTML ]; const TABLE_CELLS = [TAG_ID.TD, TAG_ID.TH]; const SPECIAL = 1; const LIST_ITEM_BOUNDARY = 2; const SCOPE = 4; const LIST_ITEM_SCOPE = 8; const BUTTON_SCOPE = 16; const TABLE_SCOPE = 32; const KEY_CLASSES = new Uint8Array(NAME_KEYS); for (const [ns, offset] of [ [NS.HTML, 0], [NS.SVG, SVG_KEYS], [NS.MATHML, MATHML_KEYS] ]) for (const tn of SPECIAL_ELEMENTS[ns]) KEY_CLASSES[offset + tn] = ns === NS.HTML && (tn === TAG_ID.ADDRESS || tn === TAG_ID.DIV || tn === TAG_ID.P) ? SPECIAL : 3; for (const key of [ TAG_ID.APPLET, TAG_ID.CAPTION, TAG_ID.HTML, TAG_ID.MARQUEE, TAG_ID.OBJECT, TAG_ID.TABLE, TAG_ID.TD, TAG_ID.TEMPLATE, TAG_ID.TH, SVG_KEYS + TAG_ID.DESC, SVG_KEYS + TAG_ID.FOREIGN_OBJECT, SVG_KEYS + TAG_ID.TITLE, MATHML_KEYS + TAG_ID.ANNOTATION_XML, MATHML_KEYS + TAG_ID.MI, MATHML_KEYS + TAG_ID.MN, MATHML_KEYS + TAG_ID.MO, MATHML_KEYS + TAG_ID.MS, MATHML_KEYS + TAG_ID.MTEXT ]) KEY_CLASSES[key] |= 28; KEY_CLASSES[TAG_ID.OL] |= LIST_ITEM_SCOPE; KEY_CLASSES[TAG_ID.UL] |= LIST_ITEM_SCOPE; KEY_CLASSES[TAG_ID.BUTTON] |= BUTTON_SCOPE; KEY_CLASSES[TAG_ID.TABLE] |= TABLE_SCOPE; KEY_CLASSES[TAG_ID.HTML] |= TABLE_SCOPE; const FORMATTING_TAGS = new Uint8Array(NAME_KEYS); for (const tn of [ TAG_ID.A, TAG_ID.B, TAG_ID.BIG, TAG_ID.CODE, TAG_ID.EM, TAG_ID.FONT, TAG_ID.I, TAG_ID.NOBR, TAG_ID.S, TAG_ID.SMALL, TAG_ID.STRIKE, TAG_ID.STRONG, TAG_ID.TT, TAG_ID.U ]) FORMATTING_TAGS[tn] = 1; /** The key of an element with a tag ID in HTML, SVG or MathML, or -1 for an element keyed by its name. */ function tagKey(ns, tagID) { if (tagID === TAG_ID.UNKNOWN) return -1; switch (ns) { case NS.HTML: return tagID; case NS.SVG: return SVG_KEYS + tagID; case NS.MATHML: return MATHML_KEYS + tagID; default: return -1; } } /** * The stack of open elements. Each element has a slot in `items` and `tagIDs`. Once the stack is `INDEX_DEPTH` deep, it * indexes its elements so that the searches the parser repeats per token take constant time: it chains the elements * with each key, so that the topmost one is found without a scan, and counts per slot the special elements and scope * boundaries at or below it, which tell whether one lies between two slots. Removing an element from the middle then * leaves its slot free instead of moving the elements above it; `slotBelow` and `slotAbove` step over free slots, and * `depth` counts the open elements. */ var OpenElementStack = class { get currentTmplContentOrNode() { return this._isInTemplate() ? this.treeAdapter.getTemplateContent(this.current) : this.current; } constructor(document, treeAdapter, handler) { this.treeAdapter = treeAdapter; this.handler = handler; this.items = []; this.tagIDs = []; /** The slot of the current element. */ this.stackTop = -1; /** The number of open elements. */ this.depth = 0; this.tmplCount = 0; this.currentTagId = TAG_ID.UNKNOWN; this.indexed = false; /** The slot of the open element below, and above, each open element's slot; -1 for none. */ this.below = []; this.above = []; this.keys = []; /** The slot of the next lower, and higher, open element with the same key; -1 for none. */ this.keyPrev = []; this.keyNext = []; /** The slot of the topmost open element with each key, -1 for none. */ this.keyTops = /* @__PURE__ */ new Int32Array(0); /** Per slot, the open special elements, list item boundaries and scope boundaries at or below it. */ this.specials = []; this.listItemBoundaries = []; this.scopeBoundaries = []; /** Per slot, the slot of the topmost open HTML element at or below it, or -1. */ this.htmlSlots = []; this.formattingSlots = /* @__PURE__ */ new Map(); this.current = document; } /** The slot of an open element, or -1. */ _indexOf(element) { if (this.indexed) { const idx = this.formattingSlots.get(element); if (idx !== void 0) return idx; if (FORMATTING_TAGS[getTagID(this.treeAdapter.getTagName(element))]) return -1; } return this.items.lastIndexOf(element, this.stackTop); } /** The slot of the open element below the one at `idx`, or -1. */ slotBelow(idx) { return this.indexed ? this.below[idx] : idx - 1; } /** The slot of the open element above the one at `idx`, or -1. */ slotAbove(idx) { if (this.indexed) return this.above[idx]; return idx === this.stackTop ? -1 : idx + 1; } _isInTemplate() { return this.currentTagId === TAG_ID.TEMPLATE && this.treeAdapter.getNamespaceURI(this.current) === NS.HTML; } _updateCurrentElement() { this.current = this.items[this.stackTop]; this.currentTagId = this.tagIDs[this.stackTop]; } _nameKey(ns, tagName, create) { var _a, _b; const name = `${ns} ${tagName}`; let key = (_a = this.nameKeys) === null || _a === void 0 ? void 0 : _a.get(name); if (key === void 0 && create) { (_b = this.nameKeys) !== null && _b !== void 0 || (this.nameKeys = /* @__PURE__ */ new Map()); key = NAME_KEYS + this.nameKeys.size; this.nameKeys.set(name, key); if (key === this.keyTops.length) { const keyTops = new Int32Array(2 * key).fill(-1); keyTops.set(this.keyTops); this.keyTops = keyTops; } } return key !== null && key !== void 0 ? key : -1; } /** Indexes the open elements once the stack is `INDEX_DEPTH` deep. */ _indexAll() { this.indexed = true; this.keyTops = new Int32Array(NAME_KEYS).fill(-1); for (let i = 0; i <= this.stackTop; i++) this._index(i, i - 1); } /** Indexes the element at `slot`, above the open element at `belowIdx`. */ _index(slot, belowIdx) { const element = this.items[slot]; const tagID = this.tagIDs[slot]; const ns = this.treeAdapter.getNamespaceURI(element); let key = tagKey(ns, tagID); if (key === -1) key = this._nameKey(ns, this.treeAdapter.getTagName(element), true); const keyPrev = this.keyTops[key]; this.keys[slot] = key; this.keyPrev[slot] = keyPrev; this.keyNext[slot] = -1; if (keyPrev !== -1) this.keyNext[keyPrev] = slot; this.keyTops[key] = slot; this.above[slot] = -1; this._link(slot, belowIdx, ns === NS.HTML); if (FORMATTING_TAGS[tagID]) this.formattingSlots.set(element, slot); } /** Puts the indexed element at `slot` above the one at `belowIdx`, and counts the elements of each class. */ _link(slot, belowIdx, isHtml) { const key = this.keys[slot]; const classes = key < NAME_KEYS ? KEY_CLASSES[key] : 0; this.below[slot] = belowIdx; if (belowIdx === -1) { this.specials[slot] = classes & SPECIAL; this.listItemBoundaries[slot] = (classes & LIST_ITEM_BOUNDARY) >> 1; this.scopeBoundaries[slot] = (classes & SCOPE) >> 2; this.htmlSlots[slot] = isHtml ? slot : -1; } else { this.above[belowIdx] = slot; this.specials[slot] = this.specials[belowIdx] + (classes & SPECIAL); this.listItemBoundaries[slot] = this.listItemBoundaries[belowIdx] + ((classes & LIST_ITEM_BOUNDARY) >> 1); this.scopeBoundaries[slot] = this.scopeBoundaries[belowIdx] + ((classes & SCOPE) >> 2); this.htmlSlots[slot] = isHtml ? slot : this.htmlSlots[belowIdx]; } } /** Takes the element at `slot` out of the index, except for the links between slots. */ _unindex(slot) { const key = this.keys[slot]; const keyPrev = this.keyPrev[slot]; const keyNext = this.keyNext[slot]; if (keyPrev !== -1) this.keyNext[keyPrev] = keyNext; if (keyNext === -1) this.keyTops[key] = keyPrev; else this.keyPrev[keyNext] = keyPrev; if (FORMATTING_TAGS[this.tagIDs[slot]]) this.formattingSlots.delete(this.items[slot]); } /** Moves the indexed element at `from` down to the free slot `to`, keeping its key chain in order. */ _move(from, to) { const element = this.items[from]; const key = this.keys[from]; const keyPrev = this.keyPrev[from]; const keyNext = this.keyNext[from]; this.items[to] = element; this.tagIDs[to] = this.tagIDs[from]; this.keys[to] = key; this.keyPrev[to] = keyPrev; this.keyNext[to] = keyNext; if (keyPrev !== -1) this.keyNext[keyPrev] = to; if (keyNext === -1) this.keyTops[key] = to; else this.keyPrev[keyNext] = to; if (FORMATTING_TAGS[this.tagIDs[to]]) this.formattingSlots.set(element, to); } /** The slot of the topmost open HTML element with this tag, or -1. */ indexOfTopmost(tagID) { if (this.indexed) return this.keyTops[tagID]; for (let i = this.stackTop; i >= 0; i--) if (this.tagIDs[i] === tagID && this.treeAdapter.getNamespaceURI(this.items[i]) === NS.HTML) return i; return -1; } /** The slot of the topmost open HTML element with any of these tags, or -1. */ indexOfTopmostOf(tagIDs) { if (this.indexed) { let top = -1; for (const tagID of tagIDs) if (this.keyTops[tagID] > top) top = this.keyTops[tagID]; return top; } for (let i = this.stackTop; i >= 0; i--) if (tagIDs.includes(this.tagIDs[i]) && this.treeAdapter.getNamespaceURI(this.items[i]) === NS.HTML) return i; return -1; } /** The slot of the topmost open element in this namespace with this tag name, or -1. */ indexOfTopmostByName(ns, tagName) { if (this.indexed) { let key = tagKey(ns, getTagID(tagName)); if (key === -1) key = this._nameKey(ns, tagName, false); return key === -1 ? -1 : this.keyTops[key]; } for (let i = this.stackTop; i >= 0; i--) { const element = this.items[i]; if (this.treeAdapter.getTagName(element) === tagName && this.treeAdapter.getNamespaceURI(element) === ns) return i; } return -1; } /** The slot of the topmost open HTML element, or -1. */ indexOfTopmostHtmlElement() { if (this.indexed) return this.stackTop === -1 ? -1 : this.htmlSlots[this.stackTop]; let i = this.stackTop; while (i >= 0 && this.treeAdapter.getNamespaceURI(this.items[i]) !== NS.HTML) i--; return i; } /** Whether an element of the classes is open above the slot `idx`, on a stack that is not indexed. */ _hasAbove(idx, classes) { for (let i = this.stackTop; i > idx; i--) { const key = tagKey(this.treeAdapter.getNamespaceURI(this.items[i]), this.tagIDs[i]); if (key !== -1 && KEY_CLASSES[key] & classes) return true; } return false; } /** Whether a special element is open above the slot `idx`. */ hasSpecialElementAbove(idx) { return this.indexed ? this.specials[this.stackTop] !== this.specials[idx] : this._hasAbove(idx, SPECIAL); } /** Whether a special element other than HTML `address`, `div` and `p` is open above the slot `idx`. */ hasListItemBoundaryAbove(idx) { return this.indexed ? this.listItemBoundaries[this.stackTop] !== this.listItemBoundaries[idx] : this._hasAbove(idx, LIST_ITEM_BOUNDARY); } push(element, tagID) { const belowIdx = this.stackTop; this.stackTop++; this.depth++; this.items[this.stackTop] = element; this.current = element; this.tagIDs[this.stackTop] = tagID; this.currentTagId = tagID; if (this.indexed) this._index(this.stackTop, belowIdx); else if (this.depth === INDEX_DEPTH) this._indexAll(); if (this._isInTemplate()) this.tmplCount++; this.handler.onItemPush(element, tagID, true); } /** Pops the current element without calling the handler. */ _popCurrent() { if (this.tmplCount > 0 && this._isInTemplate()) this.tmplCount--; if (this.indexed) { this._unindex(this.stackTop); this.stackTop = this.below[this.stackTop]; if (this.stackTop !== -1) this.above[this.stackTop] = -1; } else this.stackTop--; this.depth--; this._updateCurrentElement(); } pop() { const popped = this.current; this._popCurrent(); this.handler.onItemPop(popped, true); } replace(oldElement, newElement) { const idx = this._indexOf(oldElement); this.items[idx] = newElement; if (this.indexed && FORMATTING_TAGS[this.tagIDs[idx]]) { this.formattingSlots.delete(oldElement); this.formattingSlots.set(newElement, idx); } if (idx === this.stackTop) this.current = newElement; } /** * The adoption agency's last stack step: removes the formatting element at `formattingIdx` and opens `element` * directly above the furthest block at `furthestBlockIdx`. On an indexed stack, only formatting elements the agency * kept are still open between them; the furthest block, with those directly below it, moves down by one slot, and * `element` takes the furthest block's slot. No open element above the furthest block moves, and as all these * elements are HTML elements and only the furthest block is special, the counts above it stay the same. */ replaceFormattingElement(formattingIdx, furthestBlockIdx, element, tagID) { const formattingElement = this.items[formattingIdx]; if (!this.indexed) { this.items.splice(formattingIdx, 1); this.tagIDs.splice(formattingIdx, 1); this.handler.onItemPop(formattingElement, false); this.items.splice(furthestBlockIdx, 0, element); this.tagIDs.splice(furthestBlockIdx, 0, tagID); if (furthestBlockIdx === this.stackTop) this._updateCurrentElement(); if (this.current && this.currentTagId !== void 0) this.handler.onItemPush(this.current, this.currentTagId, furthestBlockIdx === this.stackTop); return; } const key = this.keys[formattingIdx]; const belowIdx = this.below[formattingIdx]; const aboveIdx = this.above[furthestBlockIdx]; const kept = []; for (let i = this.above[formattingIdx]; i !== furthestBlockIdx; i = this.above[i]) kept.push(i); const keyNext = this.keyNext[formattingIdx]; this._unindex(formattingIdx); this.items[formattingIdx] = void 0; this.handler.onItemPop(formattingElement, false); let free = furthestBlockIdx - 1; while (kept.length > 0 && kept[kept.length - 1] === free) { kept.pop(); free--; } for (let i = free + 1; i <= furthestBlockIdx; i++) this._move(i, i - 1); const keyPrev = keyNext === -1 ? this.keyTops[key] : this.keyPrev[keyNext]; this.items[furthestBlockIdx] = element; this.tagIDs[furthestBlockIdx] = tagID; this.keys[furthestBlockIdx] = key; this.keyPrev[furthestBlockIdx] = keyPrev; this.keyNext[furthestBlockIdx] = keyNext; if (keyPrev !== -1) this.keyNext[keyPrev] = furthestBlockIdx; if (keyNext === -1) this.keyTops[key] = furthestBlockIdx; else this.keyPrev[keyNext] = furthestBlockIdx; if (FORMATTING_TAGS[tagID]) this.formattingSlots.set(element, furthestBlockIdx); let prev = belowIdx; for (const i of kept) { this._link(i, prev, true); prev = i; } for (let i = free; i < furthestBlockIdx; i++) { this._link(i, prev, true); prev = i; } this._link(furthestBlockIdx, prev, true); if (aboveIdx === -1) this._updateCurrentElement(); if (this.current && this.currentTagId !== void 0) this.handler.onItemPush(this.current, this.currentTagId, aboveIdx === -1); } popUntilTagNamePopped(tagName) { this.shortenToLength(Math.max(this.indexOfTopmost(tagName), 0)); } shortenToLength(idx) { while (this.stackTop >= idx) { const popped = this.current; this._popCurrent(); this.handler.onItemPop(popped, this.stackTop < idx); } } popUntilElementPopped(element) { const idx = this._indexOf(element); this.shortenToLength(Math.max(idx, 0)); } popUntilNumberedHeaderPopped() { this.shortenToLength(Math.max(this.indexOfTopmostOf(NUMBERED_HEADERS), 0)); } popUntilTableCellPopped() { this.shortenToLength(Math.max(this.indexOfTopmostOf(TABLE_CELLS), 0)); } popAllUpToHtmlElement() { this.tmplCount = 0; this.shortenToLength(1); } clearBackToTableContext() { this.shortenToLength(this.indexOfTopmostOf(TABLE_CONTEXT) + 1); } clearBackToTableBodyContext() { this.shortenToLength(this.indexOfTopmostOf(TABLE_BODY_CONTEXT) + 1); } clearBackToTableRowContext() { this.shortenToLength(this.indexOfTopmostOf(TABLE_ROW_CONTEXT) + 1); } remove(element) { const idx = this._indexOf(element); if (idx !== -1) this.removeAt(idx); } /** Removes the open element at the slot `idx`; on an indexed stack, the elements above it keep their slots. */ removeAt(idx) { if (idx === this.stackTop) { this.pop(); return; } const element = this.items[idx]; this.depth--; if (this.indexed) { const classes = this.keys[idx] < NAME_KEYS ? KEY_CLASSES[this.keys[idx]] : 0; const belowIdx = this.below[idx]; const aboveIdx = this.above[idx]; this._unindex(idx); this.items[idx] = void 0; this.below[aboveIdx] = belowIdx; if (belowIdx !== -1) this.above[belowIdx] = aboveIdx; if (classes !== 0) for (let i = aboveIdx; i !== -1; i = this.above[i]) { this.specials[i] -= classes & SPECIAL; this.listItemBoundaries[i] -= (classes & LIST_ITEM_BOUNDARY) >> 1; this.scopeBoundaries[i] -= (classes & SCOPE) >> 2; } const html = belowIdx === -1 ? -1 : this.htmlSlots[belowIdx]; for (let i = aboveIdx; i !== -1 && this.htmlSlots[i] === idx; i = this.above[i]) this.htmlSlots[i] = html; } else { this.items.splice(idx, 1); this.tagIDs.splice(idx, 1); this.stackTop--; this._updateCurrentElement(); } this.handler.onItemPop(element, false); } tryPeekProperlyNestedBodyElement() { return this.stackTop >= 1 && this.tagIDs[1] === TAG_ID.BODY ? this.items[1] : null; } contains(element) { return this._indexOf(element) > -1; } getCommonAncestor(element) { const idx = this._indexOf(element); const belowIdx = idx === -1 ? -1 : this.slotBelow(idx); return belowIdx === -1 ? null : this.items[belowIdx]; } isRootHtmlElementCurrent() { return this.stackTop === 0 && this.tagIDs[0] === TAG_ID.HTML; } /** * On an indexed stack: whether no element of the `scope` class is open above the slot `target`. A target that is not * open is in scope only on a stack without such an element, as a scan from the top would end there. */ _isInScope(target, scope) { let boundary = -1; switch (scope) { case LIST_ITEM_SCOPE: boundary = Math.max(this.keyTops[TAG_ID.OL], this.keyTops[TAG_ID.UL]); break; case BUTTON_SCOPE: boundary = this.keyTops[TAG_ID.BUTTON]; break; case TABLE_SCOPE: boundary = Math.max(this.keyTops[TAG_ID.TABLE], this.keyTops[TAG_ID.HTML]); return target === -1 ? boundary === -1 : target >= boundary; } return target === -1 ? boundary === -1 && (this.stackTop === -1 || this.scopeBoundaries[this.stackTop] === 0) : target >= boundary && this.scopeBoundaries[this.stackTop] === this.scopeBoundaries[target]; } /** * On a stack that is not indexed: whether an HTML element with the tag, or one of the tags, and if passed the element * itself, is open above every element of the `scope` class; true if neither is open. */ _scanScope(tagID, tagIDs, scope, element) { for (let i = this.stackTop; i >= 0; i--) { const key = tagKey(this.treeAdapter.getNamespaceURI(this.items[i]), this.tagIDs[i]); if (key === -1) continue; if ((tagIDs ? tagIDs.includes(key) : key === tagID) && (!element || this.items[i] === element)) return true; if (KEY_CLASSES[key] & scope) return false; } return true; } /** If `element` is passed, only that element (which has to be a `tagName` element) is looked for. */ hasInScope(tagName, element) { if (!this.indexed) return this._scanScope(tagName, null, SCOPE, element); return this._isInScope(element ? this._indexOf(element) : this.keyTops[tagName], SCOPE); } hasInListItemScope(tagName) { return this.indexed ? this._isInScope(this.keyTops[tagName], LIST_ITEM_SCOPE) : this._scanScope(tagName, null, LIST_ITEM_SCOPE); } hasInButtonScope(tagName) { return this.indexed ? this._isInScope(this.keyTops[tagName], BUTTON_SCOPE) : this._scanScope(tagName, null, BUTTON_SCOPE); } hasNumberedHeaderInScope() { return this.indexed ? this._isInScope(this.indexOfTopmostOf(NUMBERED_HEADERS), SCOPE) : this._scanScope(TAG_ID.UNKNOWN, NUMBERED_HEADERS, SCOPE); } hasInTableScope(tagName) { return this.indexed ? this._isInScope(this.keyTops[tagName], TABLE_SCOPE) : this._scanScope(tagName, null, TABLE_SCOPE); } hasTableBodyContextInTableScope() { return this.indexed ? this._isInScope(this.indexOfTopmostOf(TABLE_BODIES), TABLE_SCOPE) : this._scanScope(TAG_ID.UNKNOWN, TABLE_BODIES, TABLE_SCOPE); } hasInSelectScope(tagName) { for (let i = this.stackTop; i >= 0; i = this.slotBelow(i)) { if (this.treeAdapter.getNamespaceURI(this.items[i]) !== NS.HTML) continue; switch (this.tagIDs[i]) { case tagName: return true; case TAG_ID.OPTION: case TAG_ID.OPTGROUP: break; default: return false; } } return true; } generateImpliedEndTags() { while (this.currentTagId !== void 0 && IMPLICIT_END_TAG_REQUIRED.has(this.currentTagId) && this.treeAdapter.getNamespaceURI(this.current) === NS.HTML) this.pop(); } generateImpliedEndTagsThoroughly() { while (this.currentTagId !== void 0 && IMPLICIT_END_TAG_REQUIRED_THOROUGHLY.has(this.currentTagId) && this.treeAdapter.getNamespaceURI(this.current) === NS.HTML) this.pop(); } generateImpliedEndTagsWithExclusion(exclusionId) { while (this.currentTagId !== void 0 && this.currentTagId !== exclusionId && IMPLICIT_END_TAG_REQUIRED_THOROUGHLY.has(this.currentTagId) && this.treeAdapter.getNamespaceURI(this.current) === NS.HTML) this.pop(); } }; // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/parser/formatting-element-list.js const NOAH_ARK_CAPACITY = 3; var EntryType; (function(EntryType) { EntryType[EntryType["Marker"] = 0] = "Marker"; EntryType[EntryType["Element"] = 1] = "Element"; })(EntryType || (EntryType = {})); var FormattingElementList = class { constructor() { this.newest = null; this.bookmark = null; /** The index of the entries after the last marker; null only while there are at most NOAH_ARK_CAPACITY of them. */ this.index = null; /** The entries by element, except possibly those after the last marker while they are not indexed. */ this.elementEntries = /* @__PURE__ */ new Map(); } /** Returns the entry's ark, or null if the entries after the last marker are not indexed. */ _insertElementEntry(element, token, older) { const newer = older === null ? null : older.newer; const entry = { type: EntryType.Element, element, token, older, newer, ark: null, olderSameTag: null, newerSameTag: null }; if (newer === null) this.newest = entry; else newer.older = entry; if (older !== null) older.newer = entry; return this.index === null ? null : this._addToIndex(this.index, entry); } _addToIndex(index, entry) { const { tagName, attrs } = entry.token; const key = tagName + attrs.map(({ name, value }) => `\0${name}\0${value}`).sort().join(""); let ark = index.arks.get(key); if (ark === void 0) { ark = { entries: [], key }; index.arks.set(key, ark); } ark.entries.push(entry); entry.ark = ark; this.elementEntries.set(entry.element, entry); let head = index.tagNames.get(tagName); if (head === void 0) { head = { olderSameTag: null }; index.tagNames.set(tagName, head); } entry.olderSameTag = head.olderSameTag; entry.newerSameTag = head; if (head.olderSameTag !== null) head.olderSameTag.newerSameTag = entry; head.olderSameTag = entry; return ark; } insertMarker() { if (this.index === null) for (let entry = this.newest; entry !== null && entry.type === EntryType.Element; entry = entry.older) this.elementEntries.set(entry.element, entry); const marker = { type: EntryType.Marker, older: this.newest, newer: null, outerIndex: this.index }; if (this.newest !== null) this.newest.newer = marker; this.newest = marker; this.index = null; } pushElement(element, token) { if (this.index === null) { let oldest = null; let count = 0; for (let entry = this.newest; entry !== null && entry.type === EntryType.Element; entry = entry.older) { oldest = entry; count++; } if (count >= NOAH_ARK_CAPACITY) { this.index = { arks: /* @__PURE__ */ new Map(), tagNames: /* @__PURE__ */ new Map() }; for (let entry = oldest; entry !== null && entry.type === EntryType.Element; entry = entry.newer) this._addToIndex(this.index, entry); } } const ark = this._insertElementEntry(element, token, this.newest); if (ark !== null && ark.entries.length > NOAH_ARK_CAPACITY) this.removeEntry(ark.entries[0]); } insertElementAfterBookmark(element, token) { const { bookmark } = this; this.bookmark = null; this._insertElementEntry(element, token, bookmark); } removeEntry(entry) { var _a; if (entry.newer === null ? this.newest !== entry : entry.newer.older !== entry) return; this.elementEntries.delete(entry.element); if (entry.newer === null) this.newest = entry.older; else entry.newer.older = entry.older; if (entry.older !== null) entry.older.newer = entry.newer; if (entry.ark !== null) { const { entries, key } = entry.ark; entries.splice(entries.indexOf(entry), 1); if (entries.length === 0) (_a = this.index) === null || _a === void 0 || _a.arks.delete(key); } if (entry.newerSameTag !== null) { entry.newerSameTag.olderSameTag = entry.olderSameTag; if (entry.olderSameTag !== null) entry.olderSameTag.newerSameTag = entry.newerSameTag; } } replaceElement(entry, element) { if (this.elementEntries.delete(entry.element)) this.elementEntries.set(element, entry); entry.element = element; } /** * Clears the list of formatting elements up to the last marker. * * @see https://html.spec.whatwg.org/multipage/parsing.html#clear-the-list-of-active-formatting-elements-up-to-the-last-marker */ clearToLastMarker() { let marker = this.newest; for (; marker !== null && marker.type === EntryType.Element; marker = marker.older) this.elementEntries.delete(marker.element); this.newest = marker === null ? null : marker.older; this.index = marker === null ? null : marker.outerIndex; if (this.newest !== null) this.newest.newer = null; } getElementEntryInScopeWithTagName(tagName) { var _a, _b; if (this.index !== null) return (_b = (_a = this.index.tagNames.get(tagName)) === null || _a === void 0 ? void 0 : _a.olderSameTag) !== null && _b !== void 0 ? _b : null; for (let entry = this.newest; entry !== null && entry.type === EntryType.Element; entry = entry.older) if (entry.token.tagName === tagName) return entry; return null; } getElementEntry(element) { if (this.index === null) { for (let entry = this.newest; entry !== null && entry.type === EntryType.Element; entry = entry.older) if (entry.element === element) return entry; } return this.elementEntries.get(element); } }; // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/tree-adapters/default.js /** The position of each name in the attribute lists `adoptAttributes` merged into, kept for the next merge into that list. */ const attrListIndexes = /* @__PURE__ */ new WeakMap(); const defaultTreeAdapter = { createDocument() { return { nodeName: "#document", mode: DOCUMENT_MODE.NO_QUIRKS, childNodes: [] }; }, createDocumentFragment() { return { nodeName: "#document-fragment", childNodes: [] }; }, createElement(tagName, namespaceURI, attrs) { return { nodeName: tagName, tagName, attrs, namespaceURI, childNodes: [], parentNode: null }; }, createCommentNode(data) { return { nodeName: "#comment", data, parentNode: null }; }, createTextNode(value) { return { nodeName: "#text", value, parentNode: null }; }, appendChild(parentNode, newNode) { parentNode.childNodes.push(newNode); newNode.parentNode = parentNode; }, insertBefore(parentNode, newNode, referenceNode) { const { childNodes } = parentNode; const insertionIdx = childNodes[childNodes.length - 1] === referenceNode ? childNodes.length - 1 : childNodes.indexOf(referenceNode); childNodes.splice(insertionIdx, 0, newNode); newNode.parentNode = parentNode; }, setTemplateContent(templateElement, contentElement) { templateElement.content = contentElement; }, getTemplateContent(templateElement) { return templateElement.content; }, setDocumentType(document, name, publicId, systemId) { const doctypeNode = document.childNodes.find((node) => node.nodeName === "#documentType"); if (doctypeNode) { doctypeNode.name = name; doctypeNode.publicId = publicId; doctypeNode.systemId = systemId; } else defaultTreeAdapter.appendChild(document, { nodeName: "#documentType", name, publicId, systemId, parentNode: null }); }, setDocumentMode(document, mode) { document.mode = mode; }, getDocumentMode(document) { return document.mode; }, detachNode(node) { if (node.parentNode) { const { childNodes } = node.parentNode; const idx = childNodes[childNodes.length - 1] === node ? childNodes.length - 1 : childNodes.indexOf(node); childNodes.splice(idx, 1); node.parentNode = null; } }, insertText(parentNode, text) { if (parentNode.childNodes.length > 0) { const prevNode = parentNode.childNodes[parentNode.childNodes.length - 1]; if (defaultTreeAdapter.isTextNode(prevNode)) { prevNode.value += text; return; } } defaultTreeAdapter.appendChild(parentNode, defaultTreeAdapter.createTextNode(text)); }, insertTextBefore(parentNode, text, referenceNode) { const { childNodes } = parentNode; const prevNode = childNodes[(childNodes[childNodes.length - 1] === referenceNode ? childNodes.length - 1 : childNodes.indexOf(referenceNode)) - 1]; if (prevNode && defaultTreeAdapter.isTextNode(prevNode)) prevNode.value += text; else defaultTreeAdapter.insertBefore(parentNode, defaultTreeAdapter.createTextNode(text), referenceNode); }, /** * Keeps the recipient's names between merges as a map from name to position. The map is rebuilt when the list changed * length or has a repeated name, or when a merged name it holds no longer names the entry at that position. A name that * other code gives an existing entry between two merges is missed otherwise, and merging it appends it a second time. */ adoptAttributes(recipient, attrs) { if (attrs.length === 0 || attrs === recipient.attrs) return; const cached = attrListIndexes.get(recipient.attrs); const isIndexed = (cached === null || cached === void 0 ? void 0 : cached.size) === recipient.attrs.length && attrs.every(({ name }) => { var _a; const index = cached.get(name); return index === void 0 || ((_a = recipient.attrs[index]) === null || _a === void 0 ? void 0 : _a.name) === name; }); const recipientAttrsMap = isIndexed ? cached : /* @__PURE__ */ new Map(); if (!isIndexed) { for (let i = 0; i < recipient.attrs.length; i++) { const attr = recipient.attrs[i]; if (attr !== void 0) recipientAttrsMap.set(attr.name, i); } attrListIndexes.set(recipient.attrs, recipientAttrsMap); } const adoptedFrom = recipient.attrs.length; for (let j = 0; j < attrs.length; j++) if (!recipientAttrsMap.has(attrs[j].name)) recipient.attrs.push(attrs[j]); for (let j = adoptedFrom; j < recipient.attrs.length; j++) recipientAttrsMap.set(recipient.attrs[j].name, j); if (recipientAttrsMap.size !== recipient.attrs.length) attrListIndexes.delete(recipient.attrs); }, getFirstChild(node) { return node.childNodes[0]; }, getChildNodes(node) { return node.childNodes; }, getParentNode(node) { return node.parentNode; }, getAttrList(element) { return element.attrs; }, getTagName(element) { return element.tagName; }, getNamespaceURI(element) { return element.namespaceURI; }, getTextNodeContent(textNode) { return textNode.value; }, getCommentNodeContent(commentNode) { return commentNode.data; }, getDocumentTypeNodeName(doctypeNode) { return doctypeNode.name; }, getDocumentTypeNodePublicId(doctypeNode) { return doctypeNode.publicId; }, getDocumentTypeNodeSystemId(doctypeNode) { return doctypeNode.systemId; }, isTextNode(node) { return node.nodeName === "#text"; }, isCommentNode(node) { return node.nodeName === "#comment"; }, isDocumentTypeNode(node) { return node.nodeName === "#documentType"; }, isElementNode(node) { return Object.prototype.hasOwnProperty.call(node, "tagName"); }, setNodeSourceCodeLocation(node, location) { node.sourceCodeLocation = location; }, getNodeSourceCodeLocation(node) { return node.sourceCodeLocation; }, updateNodeSourceCodeLocation(node, endLocation) { node.sourceCodeLocation = { ...node.sourceCodeLocation, ...endLocation }; } }; // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/common/doctype.js const VALID_DOCTYPE_NAME = "html"; const VALID_SYSTEM_ID = "about:legacy-compat"; const QUIRKS_MODE_SYSTEM_ID = "http://www.ibm.com/data/dtd/v11/ibmxhtml1-transitional.dtd"; const QUIRKS_MODE_PUBLIC_ID_PREFIXES = [ "+//silmaril//dtd html pro v0r11 19970101//", "-//as//dtd html 3.0 aswedit + extensions//", "-//advasoft ltd//dtd html 3.0 aswedit + extensions//", "-//ietf//dtd html 2.0 level 1//", "-//ietf//dtd html 2.0 level 2//", "-//ietf//dtd html 2.0 strict level 1//", "-//ietf//dtd html 2.0 strict level 2//", "-//ietf//dtd html 2.0 strict//", "-//ietf//dtd html 2.0//", "-//ietf//dtd html 2.1e//", "-//ietf//dtd html 3.0//", "-//ietf//dtd html 3.2 final//", "-//ietf//dtd html 3.2//", "-//ietf//dtd html 3//", "-//ietf//dtd html level 0//", "-//ietf//dtd html level 1//", "-//ietf//dtd html level 2//", "-//ietf//dtd html level 3//", "-//ietf//dtd html strict level 0//", "-//ietf//dtd html strict level 1//", "-//ietf//dtd html strict level 2//", "-//ietf//dtd html strict level 3//", "-//ietf//dtd html strict//", "-//ietf//dtd html//", "-//metrius//dtd metrius presentational//", "-//microsoft//dtd internet explorer 2.0 html strict//", "-//microsoft//dtd internet explorer 2.0 html//", "-//microsoft//dtd internet explorer 2.0 tables//", "-//microsoft//dtd internet explorer 3.0 html strict//", "-//microsoft//dtd internet explorer 3.0 html//", "-//microsoft//dtd internet explorer 3.0 tables//", "-//netscape comm. corp.//dtd html//", "-//netscape comm. corp.//dtd strict html//", "-//o'reilly and associates//dtd html 2.0//", "-//o'reilly and associates//dtd html extended 1.0//", "-//o'reilly and associates//dtd html extended relaxed 1.0//", "-//sq//dtd html 2.0 hotmetal + extensions//", "-//softquad software//dtd hotmetal pro 6.0::19990601::extensions to html 4.0//", "-//softquad//dtd hotmetal pro 4.0::19971010::extensions to html 4.0//", "-//spyglass//dtd html 2.0 extended//", "-//sun microsystems corp.//dtd hotjava html//", "-//sun microsystems corp.//dtd hotjava strict html//", "-//w3c//dtd html 3 1995-03-24//", "-//w3c//dtd html 3.2 draft//", "-//w3c//dtd html 3.2 final//", "-//w3c//dtd html 3.2//", "-//w3c//dtd html 3.2s draft//", "-//w3c//dtd html 4.0 frameset//", "-//w3c//dtd html 4.0 transitional//", "-//w3c//dtd html experimental 19960712//", "-//w3c//dtd html experimental 970421//", "-//w3c//dtd w3 html//", "-//w3o//dtd w3 html 3.0//", "-//webtechs//dtd mozilla html 2.0//", "-//webtechs//dtd mozilla html//" ]; const QUIRKS_MODE_NO_SYSTEM_ID_PUBLIC_ID_PREFIXES = [ ...QUIRKS_MODE_PUBLIC_ID_PREFIXES, "-//w3c//dtd html 4.01 frameset//", "-//w3c//dtd html 4.01 transitional//" ]; const QUIRKS_MODE_PUBLIC_IDS = /* @__PURE__ */ new Set([ "-//w3o//dtd w3 html strict 3.0//en//", "-/w3c/dtd html 4.0 transitional/en", "html" ]); const LIMITED_QUIRKS_PUBLIC_ID_PREFIXES = ["-//w3c//dtd xhtml 1.0 frameset//", "-//w3c//dtd xhtml 1.0 transitional//"]; const LIMITED_QUIRKS_WITH_SYSTEM_ID_PUBLIC_ID_PREFIXES = [ ...LIMITED_QUIRKS_PUBLIC_ID_PREFIXES, "-//w3c//dtd html 4.01 frameset//", "-//w3c//dtd html 4.01 transitional//" ]; function hasPrefix(publicId, prefixes) { return prefixes.some((prefix) => publicId.startsWith(prefix)); } function isConforming(token) { return token.name === VALID_DOCTYPE_NAME && token.publicId === null && (token.systemId === null || token.systemId === VALID_SYSTEM_ID); } function getDocumentMode(token) { if (token.name !== VALID_DOCTYPE_NAME) return DOCUMENT_MODE.QUIRKS; const { systemId } = token; if (systemId && systemId.toLowerCase() === QUIRKS_MODE_SYSTEM_ID) return DOCUMENT_MODE.QUIRKS; let { publicId } = token; if (publicId !== null) { publicId = publicId.toLowerCase(); if (QUIRKS_MODE_PUBLIC_IDS.has(publicId)) return DOCUMENT_MODE.QUIRKS; let prefixes = systemId === null ? QUIRKS_MODE_NO_SYSTEM_ID_PUBLIC_ID_PREFIXES : QUIRKS_MODE_PUBLIC_ID_PREFIXES; if (hasPrefix(publicId, prefixes)) return DOCUMENT_MODE.QUIRKS; prefixes = systemId === null ? LIMITED_QUIRKS_PUBLIC_ID_PREFIXES : LIMITED_QUIRKS_WITH_SYSTEM_ID_PUBLIC_ID_PREFIXES; if (hasPrefix(publicId, prefixes)) return DOCUMENT_MODE.LIMITED_QUIRKS; } return DOCUMENT_MODE.NO_QUIRKS; } // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/common/foreign-content.js const MIME_TYPES = { TEXT_HTML: "text/html", APPLICATION_XML: "application/xhtml+xml" }; const DEFINITION_URL_ATTR = "definitionurl"; const ADJUSTED_DEFINITION_URL_ATTR = "definitionURL"; const SVG_ATTRS_ADJUSTMENT_MAP = new Map([ "attributeName", "attributeType", "baseFrequency", "baseProfile", "calcMode", "clipPathUnits", "diffuseConstant", "edgeMode", "filterUnits", "glyphRef", "gradientTransform", "gradientUnits", "kernelMatrix", "kernelUnitLength", "keyPoints", "keySplines", "keyTimes", "lengthAdjust", "limitingConeAngle", "markerHeight", "markerUnits", "markerWidth", "maskContentUnits", "maskUnits", "numOctaves", "pathLength", "patternContentUnits", "patternTransform", "patternUnits", "pointsAtX", "pointsAtY", "pointsAtZ", "preserveAlpha", "preserveAspectRatio", "primitiveUnits", "refX", "refY", "repeatCount", "repeatDur", "requiredExtensions", "requiredFeatures", "specularConstant", "specularExponent", "spreadMethod", "startOffset", "stdDeviation", "stitchTiles", "surfaceScale", "systemLanguage", "tableValues", "targetX", "targetY", "textLength", "viewBox", "viewTarget", "xChannelSelector", "yChannelSelector", "zoomAndPan" ].map((attr) => [attr.toLowerCase(), attr])); const XML_ATTRS_ADJUSTMENT_MAP = /* @__PURE__ */ new Map([ ["xlink:actuate", { prefix: "xlink", name: "actuate", namespace: NS.XLINK }], ["xlink:arcrole", { prefix: "xlink", name: "arcrole", namespace: NS.XLINK }], ["xlink:href", { prefix: "xlink", name: "href", namespace: NS.XLINK }], ["xlink:role", { prefix: "xlink", name: "role", namespace: NS.XLINK }], ["xlink:show", { prefix: "xlink", name: "show", namespace: NS.XLINK }], ["xlink:title", { prefix: "xlink", name: "title", namespace: NS.XLINK }], ["xlink:type", { prefix: "xlink", name: "type", namespace: NS.XLINK }], ["xml:lang", { prefix: "xml", name: "lang", namespace: NS.XML }], ["xml:space", { prefix: "xml", name: "space", namespace: NS.XML }], ["xmlns", { prefix: "", name: "xmlns", namespace: NS.XMLNS }], ["xmlns:xlink", { prefix: "xmlns", name: "xlink", namespace: NS.XMLNS }] ]); const SVG_TAG_NAMES_ADJUSTMENT_MAP = new Map([ "altGlyph", "altGlyphDef", "altGlyphItem", "animateColor", "animateMotion", "animateTransform", "clipPath", "feBlend", "feColorMatrix", "feComponentTransfer", "feComposite", "feConvolveMatrix", "feDiffuseLighting", "feDisplacementMap", "feDistantLight", "feFlood", "feFuncA", "feFuncB", "feFuncG", "feFuncR", "feGaussianBlur", "feImage", "feMerge", "feMergeNode", "feMorphology", "feOffset", "fePointLight", "feSpecularLighting", "feSpotLight", "feTile", "feTurbulence", "foreignObject", "glyphRef", "linearGradient", "radialGradient", "textPath" ].map((tn) => [tn.toLowerCase(), tn])); const EXITS_FOREIGN_CONTENT = /* @__PURE__ */ new Set([ TAG_ID.B, TAG_ID.BIG, TAG_ID.BLOCKQUOTE, TAG_ID.BODY, TAG_ID.BR, TAG_ID.CENTER, TAG_ID.CODE, TAG_ID.DD, TAG_ID.DIV, TAG_ID.DL, TAG_ID.DT, TAG_ID.EM, TAG_ID.EMBED, TAG_ID.H1, TAG_ID.H2, TAG_ID.H3, TAG_ID.H4, TAG_ID.H5, TAG_ID.H6, TAG_ID.HEAD, TAG_ID.HR, TAG_ID.I, TAG_ID.IMG, TAG_ID.LI, TAG_ID.LISTING, TAG_ID.MENU, TAG_ID.META, TAG_ID.NOBR, TAG_ID.OL, TAG_ID.P, TAG_ID.PRE, TAG_ID.RUBY, TAG_ID.S, TAG_ID.SMALL, TAG_ID.SPAN, TAG_ID.STRONG, TAG_ID.STRIKE, TAG_ID.SUB, TAG_ID.SUP, TAG_ID.TABLE, TAG_ID.TT, TAG_ID.U, TAG_ID.UL, TAG_ID.VAR ]); function causesExit(startTagToken) { const tn = startTagToken.tagID; return tn === TAG_ID.FONT && startTagToken.attrs.some(({ name }) => name === ATTRS.COLOR || name === ATTRS.SIZE || name === ATTRS.FACE) || EXITS_FOREIGN_CONTENT.has(tn); } function adjustTokenMathMLAttrs(token) { for (let i = 0; i < token.attrs.length; i++) if (token.attrs[i].name === DEFINITION_URL_ATTR) { token.attrs[i].name = ADJUSTED_DEFINITION_URL_ATTR; break; } } function adjustTokenSVGAttrs(token) { for (let i = 0; i < token.attrs.length; i++) { const adjustedAttrName = SVG_ATTRS_ADJUSTMENT_MAP.get(token.attrs[i].name); if (adjustedAttrName != null) token.attrs[i].name = adjustedAttrName; } } function adjustTokenXMLAttrs(token) { for (let i = 0; i < token.attrs.length; i++) { const adjustedAttrEntry = XML_ATTRS_ADJUSTMENT_MAP.get(token.attrs[i].name); if (adjustedAttrEntry) { token.attrs[i].prefix = adjustedAttrEntry.prefix; token.attrs[i].name = adjustedAttrEntry.name; token.attrs[i].namespace = adjustedAttrEntry.namespace; } } } function adjustTokenSVGTagName(token) { const adjustedTagName = SVG_TAG_NAMES_ADJUSTMENT_MAP.get(token.tagName); if (adjustedTagName != null) { token.tagName = adjustedTagName; token.tagID = getTagID(token.tagName); } } function isMathMLTextIntegrationPoint(tn, ns) { return ns === NS.MATHML && (tn === TAG_ID.MI || tn === TAG_ID.MO || tn === TAG_ID.MN || tn === TAG_ID.MS || tn === TAG_ID.MTEXT); } function isHtmlIntegrationPoint(tn, ns, attrs) { if (ns === NS.MATHML && tn === TAG_ID.ANNOTATION_XML) { for (let i = 0; i < attrs.length; i++) if (attrs[i].name === ATTRS.ENCODING) { const value = attrs[i].value.toLowerCase(); return value === MIME_TYPES.TEXT_HTML || value === MIME_TYPES.APPLICATION_XML; } } return ns === NS.SVG && (tn === TAG_ID.FOREIGN_OBJECT || tn === TAG_ID.DESC || tn === TAG_ID.TITLE); } function isIntegrationPoint(tn, ns, attrs, foreignNS) { return (!foreignNS || foreignNS === NS.HTML) && isHtmlIntegrationPoint(tn, ns, attrs) || (!foreignNS || foreignNS === NS.MATHML) && isMathMLTextIntegrationPoint(tn, ns); } // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/parser/index.js const INSERTION_MODE_TAGS = [ TAG_ID.TR, TAG_ID.TBODY, TAG_ID.THEAD, TAG_ID.TFOOT, TAG_ID.CAPTION, TAG_ID.COLGROUP, TAG_ID.TABLE, TAG_ID.FRAMESET, TAG_ID.SELECT, TAG_ID.TEMPLATE, TAG_ID.TD, TAG_ID.TH, TAG_ID.HEAD, TAG_ID.BODY, TAG_ID.HTML ]; const HIDDEN_INPUT_TYPE = "hidden"; const EMPTY_ATTRS = []; const AA_OUTER_LOOP_ITER = 8; const AA_INNER_LOOP_ITER = 3; var InsertionMode; (function(InsertionMode) { InsertionMode[InsertionMode["INITIAL"] = 0] = "INITIAL"; InsertionMode[InsertionMode["BEFORE_HTML"] = 1] = "BEFORE_HTML"; InsertionMode[InsertionMode["BEFORE_HEAD"] = 2] = "BEFORE_HEAD"; InsertionMode[InsertionMode["IN_HEAD"] = 3] = "IN_HEAD"; InsertionMode[InsertionMode["IN_HEAD_NO_SCRIPT"] = 4] = "IN_HEAD_NO_SCRIPT"; InsertionMode[InsertionMode["AFTER_HEAD"] = 5] = "AFTER_HEAD"; InsertionMode[InsertionMode["IN_BODY"] = 6] = "IN_BODY"; InsertionMode[InsertionMode["TEXT"] = 7] = "TEXT"; InsertionMode[InsertionMode["IN_TABLE"] = 8] = "IN_TABLE"; InsertionMode[InsertionMode["IN_TABLE_TEXT"] = 9] = "IN_TABLE_TEXT"; InsertionMode[InsertionMode["IN_CAPTION"] = 10] = "IN_CAPTION"; InsertionMode[InsertionMode["IN_COLUMN_GROUP"] = 11] = "IN_COLUMN_GROUP"; InsertionMode[InsertionMode["IN_TABLE_BODY"] = 12] = "IN_TABLE_BODY"; InsertionMode[InsertionMode["IN_ROW"] = 13] = "IN_ROW"; InsertionMode[InsertionMode["IN_CELL"] = 14] = "IN_CELL"; InsertionMode[InsertionMode["IN_SELECT"] = 15] = "IN_SELECT"; InsertionMode[InsertionMode["IN_SELECT_IN_TABLE"] = 16] = "IN_SELECT_IN_TABLE"; InsertionMode[InsertionMode["IN_TEMPLATE"] = 17] = "IN_TEMPLATE"; InsertionMode[InsertionMode["AFTER_BODY"] = 18] = "AFTER_BODY"; InsertionMode[InsertionMode["IN_FRAMESET"] = 19] = "IN_FRAMESET"; InsertionMode[InsertionMode["AFTER_FRAMESET"] = 20] = "AFTER_FRAMESET"; InsertionMode[InsertionMode["AFTER_AFTER_BODY"] = 21] = "AFTER_AFTER_BODY"; InsertionMode[InsertionMode["AFTER_AFTER_FRAMESET"] = 22] = "AFTER_AFTER_FRAMESET"; })(InsertionMode || (InsertionMode = {})); const BASE_LOC = { startLine: -1, startCol: -1, startOffset: -1, endLine: -1, endCol: -1, endOffset: -1 }; const TABLE_STRUCTURE_TAGS = /* @__PURE__ */ new Set([ TAG_ID.TABLE, TAG_ID.TBODY, TAG_ID.TFOOT, TAG_ID.THEAD, TAG_ID.TR ]); const defaultParserOptions = { scriptingEnabled: true, sourceCodeLocationInfo: false, treeAdapter: defaultTreeAdapter, onParseError: null }; var Parser = class { constructor(options, document, fragmentContext = null, scriptHandler = null) { this.fragmentContext = fragmentContext; this.scriptHandler = scriptHandler; this.currentToken = null; this.stopped = false; /** @internal */ this.insertionMode = InsertionMode.INITIAL; /** @internal */ this.originalInsertionMode = InsertionMode.INITIAL; /** @internal */ this.headElement = null; /** @internal */ this.formElement = null; /** Indicates that the current node is not an element in the HTML namespace */ this.currentNotInHTML = false; /** * The topmost template insertion mode is the last element. * * @internal */ this.tmplInsertionModeStack = []; /** @internal */ this.pendingCharacterTokens = []; /** @internal */ this.hasNonWhitespacePendingCharacterToken = false; /** @internal */ this.framesetOk = true; /** @internal */ this.skipNextNewLine = false; /** @internal */ this.fosterParentingEnabled = false; this.options = { ...defaultParserOptions, ...options }; this.treeAdapter = this.options.treeAdapter; this.onParseError = this.options.onParseError; if (this.onParseError) this.options.sourceCodeLocationInfo = true; this.document = document !== null && document !== void 0 ? document : this.treeAdapter.createDocument(); this.tokenizer = new Tokenizer(this.options, this); this.activeFormattingElements = new FormattingElementList(); this.fragmentContextID = fragmentContext ? getTagID(this.treeAdapter.getTagName(fragmentContext)) : TAG_ID.UNKNOWN; this._setContextModes(fragmentContext !== null && fragmentContext !== void 0 ? fragmentContext : this.document, this.fragmentContextID); this.openElements = new OpenElementStack(this.document, this.treeAdapter, this); } static parse(html, options) { const parser = new this(options); parser.tokenizer.write(html, true); return parser.document; } static getFragmentParser(fragmentContext, options) { const opts = { ...defaultParserOptions, ...options }; fragmentContext !== null && fragmentContext !== void 0 || (fragmentContext = opts.treeAdapter.createElement(TAG_NAMES.TEMPLATE, NS.HTML, [])); const documentMock = opts.treeAdapter.createElement("documentmock", NS.HTML, []); const parser = new this(opts, documentMock, fragmentContext); if (parser.fragmentContextID === TAG_ID.TEMPLATE) parser.tmplInsertionModeStack.push(InsertionMode.IN_TEMPLATE); parser._initTokenizerForFragmentParsing(); parser._insertFakeRootElement(); parser._resetInsertionMode(); parser._findFormInFragmentContext(); return parser; } getFragment() { const rootElement = this.treeAdapter.getFirstChild(this.document); const fragment = this.treeAdapter.createDocumentFragment(); this._adoptNodes(rootElement, fragment); return fragment; } /** @internal */ _err(token, code, beforeToken) { var _a; if (!this.onParseError) return; const loc = (_a = token.location) !== null && _a !== void 0 ? _a : BASE_LOC; const err = { code, startLine: loc.startLine, startCol: loc.startCol, startOffset: loc.startOffset, endLine: beforeToken ? loc.startLine : loc.endLine, endCol: beforeToken ? loc.startCol : loc.endCol, endOffset: beforeToken ? loc.startOffset : loc.endOffset }; this.onParseError(err); } /** @internal */ onItemPush(node, tid, isTop) { var _a, _b; (_b = (_a = this.treeAdapter).onItemPush) === null || _b === void 0 || _b.call(_a, node); if (isTop && this.openElements.stackTop > 0) this._setContextModes(node, tid); } /** @internal */ onItemPop(node, isTop) { var _a, _b, _c; if (this.options.sourceCodeLocationInfo) this._setEndLocation(node, this.currentToken); (_b = (_a = this.treeAdapter).onItemPop) === null || _b === void 0 || _b.call(_a, node, this.openElements.current); (_c = this.annotationXmlIntegrationPoints) === null || _c === void 0 || _c.delete(node); if (isTop) { let current; let currentTagId; if (this.openElements.stackTop === 0 && this.fragmentContext) { current = this.fragmentContext; currentTagId = this.fragmentContextID; } else ({current, currentTagId} = this.openElements); this._setContextModes(current, currentTagId); } } _setContextModes(current, tid) { const isHTML = current === this.document || current && this.treeAdapter.getNamespaceURI(current) === NS.HTML; this.currentNotInHTML = !isHTML; this.tokenizer.inForeignNode = !isHTML && current !== void 0 && tid !== void 0 && !this._isIntegrationPoint(tid, current); } /** @protected */ _switchToTextParsing(currentToken, nextTokenizerState) { this._insertElement(currentToken, NS.HTML); this.tokenizer.state = nextTokenizerState; this.originalInsertionMode = this.insertionMode; this.insertionMode = InsertionMode.TEXT; } switchToPlaintextParsing() { this.insertionMode = InsertionMode.TEXT; this.originalInsertionMode = InsertionMode.IN_BODY; this.tokenizer.state = TokenizerMode.PLAINTEXT; } /** @protected */ _getAdjustedCurrentElement() { return this.openElements.stackTop === 0 && this.fragmentContext ? this.fragmentContext : this.openElements.current; } /** @protected */ _findFormInFragmentContext() { let node = this.fragmentContext; while (node) { if (this.treeAdapter.getTagName(node) === TAG_NAMES.FORM && this.treeAdapter.getNamespaceURI(node) === NS.HTML) { this.formElement = node; break; } node = this.treeAdapter.getParentNode(node); } } _initTokenizerForFragmentParsing() { if (!this.fragmentContext || this.treeAdapter.getNamespaceURI(this.fragmentContext) !== NS.HTML) return; switch (this.fragmentContextID) { case TAG_ID.TITLE: case TAG_ID.TEXTAREA: this.tokenizer.state = TokenizerMode.RCDATA; break; case TAG_ID.STYLE: case TAG_ID.XMP: case TAG_ID.IFRAME: case TAG_ID.NOEMBED: case TAG_ID.NOFRAMES: case TAG_ID.NOSCRIPT: this.tokenizer.state = TokenizerMode.RAWTEXT; break; case TAG_ID.SCRIPT: this.tokenizer.state = TokenizerMode.SCRIPT_DATA; break; case TAG_ID.PLAINTEXT: this.tokenizer.state = TokenizerMode.PLAINTEXT; } } /** @protected */ _setDocumentType(token) { const name = token.name || ""; const publicId = token.publicId || ""; const systemId = token.systemId || ""; this.treeAdapter.setDocumentType(this.document, name, publicId, systemId); if (token.location) { const docTypeNode = this.treeAdapter.getChildNodes(this.document).find((node) => this.treeAdapter.isDocumentTypeNode(node)); if (docTypeNode) this.treeAdapter.setNodeSourceCodeLocation(docTypeNode, token.location); } } /** @protected */ _attachElementToTree(element, location, insertionLocation) { if (this.options.sourceCodeLocationInfo) { const loc = location && { ...location, startTag: location }; this.treeAdapter.setNodeSourceCodeLocation(element, loc); } if (insertionLocation.beforeElement) this.treeAdapter.insertBefore(insertionLocation.parent, element, insertionLocation.beforeElement); else this.treeAdapter.appendChild(insertionLocation.parent, element); } /** @protected */ _getInsertionLocation() { var _a; if (this._shouldFosterParentOnInsertion()) return this._findFosterParentingLocation(); return { parent: (_a = this.openElements.currentTmplContentOrNode) !== null && _a !== void 0 ? _a : this.document, beforeElement: null }; } /** @protected */ _createElement(tagName, namespaceURI, attrs, intendedParent) { var _a, _b; const element = this.treeAdapter.createElement(tagName, namespaceURI, attrs); (_b = (_a = this.treeAdapter).onElementCreated) === null || _b === void 0 || _b.call(_a, element, { intendedParent, formElement: this.formElement, isInTemplate: this.openElements.tmplCount > 0 }); return element; } /** * For self-closing tags. Add an element to the tree, but skip adding it * to the stack. */ /** @protected */ _appendElement(token, namespaceURI) { const insertionLocation = this._getInsertionLocation(); const element = this._createElement(token.tagName, namespaceURI, token.attrs, insertionLocation.parent); this._attachElementToTree(element, token.location, insertionLocation); } /** @protected */ _insertElement(token, namespaceURI) { const insertionLocation = this._getInsertionLocation(); const element = this._createElement(token.tagName, namespaceURI, token.attrs, insertionLocation.parent); this._attachElementToTree(element, token.location, insertionLocation); this.openElements.push(element, token.tagID); } /** @protected */ _insertFakeElement(tagName, tagID) { const insertionLocation = this._getInsertionLocation(); const element = this._createElement(tagName, NS.HTML, [], insertionLocation.parent); this._attachElementToTree(element, null, insertionLocation); this.openElements.push(element, tagID); } /** @protected */ _insertTemplate(token) { const insertionLocation = this._getInsertionLocation(); const tmpl = this._createElement(token.tagName, NS.HTML, token.attrs, insertionLocation.parent); const content = this.treeAdapter.createDocumentFragment(); this.treeAdapter.setTemplateContent(tmpl, content); this._attachElementToTree(tmpl, token.location, insertionLocation); this.openElements.push(tmpl, token.tagID); if (this.options.sourceCodeLocationInfo) this.treeAdapter.setNodeSourceCodeLocation(content, null); } /** @protected */ _insertFakeRootElement() { const element = this._createElement(TAG_NAMES.HTML, NS.HTML, [], this.document); if (this.options.sourceCodeLocationInfo) this.treeAdapter.setNodeSourceCodeLocation(element, null); this.treeAdapter.appendChild(this.document, element); this.openElements.push(element, TAG_ID.HTML); } /** @protected */ _appendCommentNode(token, parent) { const commentNode = this.treeAdapter.createCommentNode(token.data); this.treeAdapter.appendChild(parent, commentNode); if (this.options.sourceCodeLocationInfo) this.treeAdapter.setNodeSourceCodeLocation(commentNode, token.location); } /** @protected */ _insertCharacters(token) { let parent; let beforeElement; if (this._shouldFosterParentOnInsertion()) { ({parent, beforeElement} = this._findFosterParentingLocation()); if (beforeElement) this.treeAdapter.insertTextBefore(parent, token.chars, beforeElement); else this.treeAdapter.insertText(parent, token.chars); } else { parent = this.openElements.currentTmplContentOrNode; this.treeAdapter.insertText(parent, token.chars); } if (!token.location) return; const siblings = this.treeAdapter.getChildNodes(parent); const textNode = siblings[(beforeElement ? siblings.lastIndexOf(beforeElement) : siblings.length) - 1]; if (this.treeAdapter.getNodeSourceCodeLocation(textNode)) { const { endLine, endCol, endOffset } = token.location; this.treeAdapter.updateNodeSourceCodeLocation(textNode, { endLine, endCol, endOffset }); } else if (this.options.sourceCodeLocationInfo) this.treeAdapter.setNodeSourceCodeLocation(textNode, token.location); } /** @protected */ _adoptNodes(donor, recipient) { const children = [...this.treeAdapter.getChildNodes(donor)]; for (let i = children.length - 1; i >= 0; i--) this.treeAdapter.detachNode(children[i]); for (const child of children) this.treeAdapter.appendChild(recipient, child); } /** @protected */ _setEndLocation(element, closingToken) { if (this.treeAdapter.getNodeSourceCodeLocation(element) && closingToken.location) { const ctLoc = closingToken.location; const tn = this.treeAdapter.getTagName(element); const endLoc = closingToken.type === TokenType.END_TAG && tn === closingToken.tagName ? { endTag: { ...ctLoc }, endLine: ctLoc.endLine, endCol: ctLoc.endCol, endOffset: ctLoc.endOffset } : { endLine: ctLoc.startLine, endCol: ctLoc.startCol, endOffset: ctLoc.startOffset }; this.treeAdapter.updateNodeSourceCodeLocation(element, endLoc); } } shouldProcessStartTagTokenInForeignContent(token) { if (!this.currentNotInHTML) return false; let current; let currentTagId; if (this.openElements.stackTop === 0 && this.fragmentContext) { current = this.fragmentContext; currentTagId = this.fragmentContextID; } else ({current, currentTagId} = this.openElements); if (token.tagID === TAG_ID.SVG && this.treeAdapter.getTagName(current) === TAG_NAMES.ANNOTATION_XML && this.treeAdapter.getNamespaceURI(current) === NS.MATHML) return false; return this.tokenizer.inForeignNode || (token.tagID === TAG_ID.MGLYPH || token.tagID === TAG_ID.MALIGNMARK) && currentTagId !== void 0 && !this._isIntegrationPoint(currentTagId, current, NS.HTML); } /** @protected */ _processToken(token) { switch (token.type) { case TokenType.CHARACTER: this.onCharacter(token); break; case TokenType.NULL_CHARACTER: this.onNullCharacter(token); break; case TokenType.COMMENT: this.onComment(token); break; case TokenType.DOCTYPE: this.onDoctype(token); break; case TokenType.START_TAG: this._processStartTag(token); break; case TokenType.END_TAG: this.onEndTag(token); break; case TokenType.EOF: this.onEof(token); break; case TokenType.WHITESPACE_CHARACTER: this.onWhitespaceCharacter(token); } } /** @protected */ _isIntegrationPoint(tid, element, foreignNS) { var _a; const ns = this.treeAdapter.getNamespaceURI(element); if (tid === TAG_ID.ANNOTATION_XML && ns === NS.MATHML && foreignNS !== NS.MATHML) { const verdicts = (_a = this.annotationXmlIntegrationPoints) !== null && _a !== void 0 ? _a : this.annotationXmlIntegrationPoints = /* @__PURE__ */ new Map(); let isIntegrationPoint$1 = verdicts.get(element); if (isIntegrationPoint$1 === void 0) { isIntegrationPoint$1 = isIntegrationPoint(tid, ns, this.treeAdapter.getAttrList(element)); verdicts.set(element, isIntegrationPoint$1); } return isIntegrationPoint$1; } return isIntegrationPoint(tid, ns, EMPTY_ATTRS, foreignNS); } /** @protected */ _reconstructActiveFormattingElements() { let oldest = null; for (let entry = this.activeFormattingElements.newest; entry !== null && entry.type === EntryType.Element && !this.openElements.contains(entry.element); entry = entry.older) oldest = entry; for (let entry = oldest; entry !== null && entry.type === EntryType.Element; entry = entry.newer) { this._insertElement(entry.token, this.treeAdapter.getNamespaceURI(entry.element)); this.activeFormattingElements.replaceElement(entry, this.openElements.current); } } /** @protected */ _closeTableCell() { this.openElements.generateImpliedEndTags(); this.openElements.popUntilTableCellPopped(); this.activeFormattingElements.clearToLastMarker(); this.insertionMode = InsertionMode.IN_ROW; } /** @protected */ _closePElement() { this.openElements.generateImpliedEndTagsWithExclusion(TAG_ID.P); this.openElements.popUntilTagNamePopped(TAG_ID.P); } /** @protected */ _resetInsertionMode() { const i = this.openElements.indexOfTopmostOf(INSERTION_MODE_TAGS); const tn = i === 0 && this.fragmentContext ? this.fragmentContextID : this.openElements.tagIDs[i]; const node = i === 0 && this.fragmentContext ? this.fragmentContext : this.openElements.items[i]; if (node !== void 0 && this.treeAdapter.getNamespaceURI(node) === NS.HTML) switch (tn) { case TAG_ID.TR: this.insertionMode = InsertionMode.IN_ROW; return; case TAG_ID.TBODY: case TAG_ID.THEAD: case TAG_ID.TFOOT: this.insertionMode = InsertionMode.IN_TABLE_BODY; return; case TAG_ID.CAPTION: this.insertionMode = InsertionMode.IN_CAPTION; return; case TAG_ID.COLGROUP: this.insertionMode = InsertionMode.IN_COLUMN_GROUP; return; case TAG_ID.TABLE: this.insertionMode = InsertionMode.IN_TABLE; return; case TAG_ID.BODY: this.insertionMode = InsertionMode.IN_BODY; return; case TAG_ID.FRAMESET: this.insertionMode = InsertionMode.IN_FRAMESET; return; case TAG_ID.SELECT: this._resetInsertionModeForSelect(i); return; case TAG_ID.TEMPLATE: this.insertionMode = this.tmplInsertionModeStack[this.tmplInsertionModeStack.length - 1]; return; case TAG_ID.HTML: this.insertionMode = this.headElement ? InsertionMode.AFTER_HEAD : InsertionMode.BEFORE_HEAD; return; case TAG_ID.TD: case TAG_ID.TH: if (i > 0) { this.insertionMode = InsertionMode.IN_CELL; return; } break; case TAG_ID.HEAD: if (i > 0) { this.insertionMode = InsertionMode.IN_HEAD; return; } } this.insertionMode = InsertionMode.IN_BODY; } /** @protected */ _resetInsertionModeForSelect(selectIdx) { if (selectIdx > 0) { const tableIdx = this.openElements.indexOfTopmost(TAG_ID.TABLE); if (tableIdx > 0 && tableIdx > this.openElements.indexOfTopmost(TAG_ID.TEMPLATE)) { this.insertionMode = InsertionMode.IN_SELECT_IN_TABLE; return; } } this.insertionMode = InsertionMode.IN_SELECT; } /** @protected */ _isElementCausesFosterParenting(tn) { return TABLE_STRUCTURE_TAGS.has(tn); } /** @protected */ _shouldFosterParentOnInsertion() { return this.fosterParentingEnabled && this.openElements.currentTagId !== void 0 && this._isElementCausesFosterParenting(this.openElements.currentTagId); } /** @protected */ _findFosterParentingLocation() { const { openElements } = this; const tableIdx = openElements.indexOfTopmost(TAG_ID.TABLE); const templateIdx = openElements.indexOfTopmost(TAG_ID.TEMPLATE); if (templateIdx > tableIdx) return { parent: this.treeAdapter.getTemplateContent(openElements.items[templateIdx]), beforeElement: null }; if (tableIdx !== -1) { const table = openElements.items[tableIdx]; const parent = this.treeAdapter.getParentNode(table); if (parent) return { parent, beforeElement: table }; return { parent: openElements.items[openElements.slotBelow(tableIdx)], beforeElement: null }; } return { parent: openElements.items[0], beforeElement: null }; } /** @protected */ _fosterParentElement(element) { const location = this._findFosterParentingLocation(); if (location.beforeElement) this.treeAdapter.insertBefore(location.parent, element, location.beforeElement); else this.treeAdapter.appendChild(location.parent, element); } /** @protected */ _isSpecialElement(element, id) { const ns = this.treeAdapter.getNamespaceURI(element); return SPECIAL_ELEMENTS[ns].has(id); } /** @internal */ onCharacter(token) { this.skipNextNewLine = false; if (this.tokenizer.inForeignNode) { characterInForeignContent(this, token); return; } switch (this.insertionMode) { case InsertionMode.INITIAL: tokenInInitialMode(this, token); break; case InsertionMode.BEFORE_HTML: tokenBeforeHtml(this, token); break; case InsertionMode.BEFORE_HEAD: tokenBeforeHead(this, token); break; case InsertionMode.IN_HEAD: tokenInHead(this, token); break; case InsertionMode.IN_HEAD_NO_SCRIPT: tokenInHeadNoScript(this, token); break; case InsertionMode.AFTER_HEAD: tokenAfterHead(this, token); break; case InsertionMode.IN_BODY: case InsertionMode.IN_CAPTION: case InsertionMode.IN_CELL: case InsertionMode.IN_TEMPLATE: characterInBody(this, token); break; case InsertionMode.TEXT: case InsertionMode.IN_SELECT: case InsertionMode.IN_SELECT_IN_TABLE: this._insertCharacters(token); break; case InsertionMode.IN_TABLE: case InsertionMode.IN_TABLE_BODY: case InsertionMode.IN_ROW: characterInTable(this, token); break; case InsertionMode.IN_TABLE_TEXT: characterInTableText(this, token); break; case InsertionMode.IN_COLUMN_GROUP: tokenInColumnGroup(this, token); break; case InsertionMode.AFTER_BODY: tokenAfterBody(this, token); break; case InsertionMode.AFTER_AFTER_BODY: tokenAfterAfterBody(this, token); } } /** @internal */ onNullCharacter(token) { this.skipNextNewLine = false; if (this.tokenizer.inForeignNode) { nullCharacterInForeignContent(this, token); return; } switch (this.insertionMode) { case InsertionMode.INITIAL: tokenInInitialMode(this, token); break; case InsertionMode.BEFORE_HTML: tokenBeforeHtml(this, token); break; case InsertionMode.BEFORE_HEAD: tokenBeforeHead(this, token); break; case InsertionMode.IN_HEAD: tokenInHead(this, token); break; case InsertionMode.IN_HEAD_NO_SCRIPT: tokenInHeadNoScript(this, token); break; case InsertionMode.AFTER_HEAD: tokenAfterHead(this, token); break; case InsertionMode.TEXT: this._insertCharacters(token); break; case InsertionMode.IN_TABLE: case InsertionMode.IN_TABLE_BODY: case InsertionMode.IN_ROW: characterInTable(this, token); break; case InsertionMode.IN_COLUMN_GROUP: tokenInColumnGroup(this, token); break; case InsertionMode.AFTER_BODY: tokenAfterBody(this, token); break; case InsertionMode.AFTER_AFTER_BODY: tokenAfterAfterBody(this, token); } } /** @internal */ onComment(token) { this.skipNextNewLine = false; if (this.currentNotInHTML) { appendComment(this, token); return; } switch (this.insertionMode) { case InsertionMode.INITIAL: case InsertionMode.BEFORE_HTML: case InsertionMode.BEFORE_HEAD: case InsertionMode.IN_HEAD: case InsertionMode.IN_HEAD_NO_SCRIPT: case InsertionMode.AFTER_HEAD: case InsertionMode.IN_BODY: case InsertionMode.IN_TABLE: case InsertionMode.IN_CAPTION: case InsertionMode.IN_COLUMN_GROUP: case InsertionMode.IN_TABLE_BODY: case InsertionMode.IN_ROW: case InsertionMode.IN_CELL: case InsertionMode.IN_SELECT: case InsertionMode.IN_SELECT_IN_TABLE: case InsertionMode.IN_TEMPLATE: case InsertionMode.IN_FRAMESET: case InsertionMode.AFTER_FRAMESET: appendComment(this, token); break; case InsertionMode.IN_TABLE_TEXT: tokenInTableText(this, token); break; case InsertionMode.AFTER_BODY: appendCommentToRootHtmlElement(this, token); break; case InsertionMode.AFTER_AFTER_BODY: case InsertionMode.AFTER_AFTER_FRAMESET: appendCommentToDocument(this, token); } } /** @internal */ onDoctype(token) { this.skipNextNewLine = false; switch (this.insertionMode) { case InsertionMode.INITIAL: doctypeInInitialMode(this, token); break; case InsertionMode.BEFORE_HEAD: case InsertionMode.IN_HEAD: case InsertionMode.IN_HEAD_NO_SCRIPT: case InsertionMode.AFTER_HEAD: this._err(token, ERR.misplacedDoctype); break; case InsertionMode.IN_TABLE_TEXT: tokenInTableText(this, token); } } /** @internal */ onStartTag(token) { this.skipNextNewLine = false; this.currentToken = token; this._processStartTag(token); if (token.selfClosing && !token.ackSelfClosing) this._err(token, ERR.nonVoidHtmlElementStartTagWithTrailingSolidus); } /** * Processes a given start tag. * * `onStartTag` checks if a self-closing tag was recognized. When a token * is moved inbetween multiple insertion modes, this check for self-closing * could lead to false positives. To avoid this, `_processStartTag` is used * for nested calls. * * @param token The token to process. * @protected */ _processStartTag(token) { if (this.shouldProcessStartTagTokenInForeignContent(token)) startTagInForeignContent(this, token); else this._startTagOutsideForeignContent(token); } /** @protected */ _startTagOutsideForeignContent(token) { switch (this.insertionMode) { case InsertionMode.INITIAL: tokenInInitialMode(this, token); break; case InsertionMode.BEFORE_HTML: startTagBeforeHtml(this, token); break; case InsertionMode.BEFORE_HEAD: startTagBeforeHead(this, token); break; case InsertionMode.IN_HEAD: startTagInHead(this, token); break; case InsertionMode.IN_HEAD_NO_SCRIPT: startTagInHeadNoScript(this, token); break; case InsertionMode.AFTER_HEAD: startTagAfterHead(this, token); break; case InsertionMode.IN_BODY: startTagInBody(this, token); break; case InsertionMode.IN_TABLE: startTagInTable(this, token); break; case InsertionMode.IN_TABLE_TEXT: tokenInTableText(this, token); break; case InsertionMode.IN_CAPTION: startTagInCaption(this, token); break; case InsertionMode.IN_COLUMN_GROUP: startTagInColumnGroup(this, token); break; case InsertionMode.IN_TABLE_BODY: startTagInTableBody(this, token); break; case InsertionMode.IN_ROW: startTagInRow(this, token); break; case InsertionMode.IN_CELL: startTagInCell(this, token); break; case InsertionMode.IN_SELECT: startTagInSelect(this, token); break; case InsertionMode.IN_SELECT_IN_TABLE: startTagInSelectInTable(this, token); break; case InsertionMode.IN_TEMPLATE: startTagInTemplate(this, token); break; case InsertionMode.AFTER_BODY: startTagAfterBody(this, token); break; case InsertionMode.IN_FRAMESET: startTagInFrameset(this, token); break; case InsertionMode.AFTER_FRAMESET: startTagAfterFrameset(this, token); break; case InsertionMode.AFTER_AFTER_BODY: startTagAfterAfterBody(this, token); break; case InsertionMode.AFTER_AFTER_FRAMESET: startTagAfterAfterFrameset(this, token); } } /** @internal */ onEndTag(token) { this.skipNextNewLine = false; this.currentToken = token; if (this.currentNotInHTML) endTagInForeignContent(this, token); else this._endTagOutsideForeignContent(token); } /** @protected */ _endTagOutsideForeignContent(token) { switch (this.insertionMode) { case InsertionMode.INITIAL: tokenInInitialMode(this, token); break; case InsertionMode.BEFORE_HTML: endTagBeforeHtml(this, token); break; case InsertionMode.BEFORE_HEAD: endTagBeforeHead(this, token); break; case InsertionMode.IN_HEAD: endTagInHead(this, token); break; case InsertionMode.IN_HEAD_NO_SCRIPT: endTagInHeadNoScript(this, token); break; case InsertionMode.AFTER_HEAD: endTagAfterHead(this, token); break; case InsertionMode.IN_BODY: endTagInBody(this, token); break; case InsertionMode.TEXT: endTagInText(this, token); break; case InsertionMode.IN_TABLE: endTagInTable(this, token); break; case InsertionMode.IN_TABLE_TEXT: tokenInTableText(this, token); break; case InsertionMode.IN_CAPTION: endTagInCaption(this, token); break; case InsertionMode.IN_COLUMN_GROUP: endTagInColumnGroup(this, token); break; case InsertionMode.IN_TABLE_BODY: endTagInTableBody(this, token); break; case InsertionMode.IN_ROW: endTagInRow(this, token); break; case InsertionMode.IN_CELL: endTagInCell(this, token); break; case InsertionMode.IN_SELECT: endTagInSelect(this, token); break; case InsertionMode.IN_SELECT_IN_TABLE: endTagInSelectInTable(this, token); break; case InsertionMode.IN_TEMPLATE: endTagInTemplate(this, token); break; case InsertionMode.AFTER_BODY: endTagAfterBody(this, token); break; case InsertionMode.IN_FRAMESET: endTagInFrameset(this, token); break; case InsertionMode.AFTER_FRAMESET: endTagAfterFrameset(this, token); break; case InsertionMode.AFTER_AFTER_BODY: tokenAfterAfterBody(this, token); } } /** @internal */ onEof(token) { switch (this.insertionMode) { case InsertionMode.INITIAL: tokenInInitialMode(this, token); break; case InsertionMode.BEFORE_HTML: tokenBeforeHtml(this, token); break; case InsertionMode.BEFORE_HEAD: tokenBeforeHead(this, token); break; case InsertionMode.IN_HEAD: tokenInHead(this, token); break; case InsertionMode.IN_HEAD_NO_SCRIPT: tokenInHeadNoScript(this, token); break; case InsertionMode.AFTER_HEAD: tokenAfterHead(this, token); break; case InsertionMode.IN_BODY: case InsertionMode.IN_TABLE: case InsertionMode.IN_CAPTION: case InsertionMode.IN_COLUMN_GROUP: case InsertionMode.IN_TABLE_BODY: case InsertionMode.IN_ROW: case InsertionMode.IN_CELL: case InsertionMode.IN_SELECT: case InsertionMode.IN_SELECT_IN_TABLE: eofInBody(this, token); break; case InsertionMode.TEXT: eofInText(this, token); break; case InsertionMode.IN_TABLE_TEXT: tokenInTableText(this, token); break; case InsertionMode.IN_TEMPLATE: eofInTemplate(this, token); break; case InsertionMode.AFTER_BODY: case InsertionMode.IN_FRAMESET: case InsertionMode.AFTER_FRAMESET: case InsertionMode.AFTER_AFTER_BODY: case InsertionMode.AFTER_AFTER_FRAMESET: stopParsing(this, token); } } /** @internal */ onWhitespaceCharacter(token) { if (this.skipNextNewLine) { this.skipNextNewLine = false; if (token.chars.charCodeAt(0) === CODE_POINTS.LINE_FEED) { if (token.chars.length === 1) return; token.chars = token.chars.substr(1); } } if (this.tokenizer.inForeignNode) { this._insertCharacters(token); return; } switch (this.insertionMode) { case InsertionMode.IN_HEAD: case InsertionMode.IN_HEAD_NO_SCRIPT: case InsertionMode.AFTER_HEAD: case InsertionMode.TEXT: case InsertionMode.IN_COLUMN_GROUP: case InsertionMode.IN_SELECT: case InsertionMode.IN_SELECT_IN_TABLE: case InsertionMode.IN_FRAMESET: case InsertionMode.AFTER_FRAMESET: this._insertCharacters(token); break; case InsertionMode.IN_BODY: case InsertionMode.IN_CAPTION: case InsertionMode.IN_CELL: case InsertionMode.IN_TEMPLATE: case InsertionMode.AFTER_BODY: case InsertionMode.AFTER_AFTER_BODY: case InsertionMode.AFTER_AFTER_FRAMESET: whitespaceCharacterInBody(this, token); break; case InsertionMode.IN_TABLE: case InsertionMode.IN_TABLE_BODY: case InsertionMode.IN_ROW: characterInTable(this, token); break; case InsertionMode.IN_TABLE_TEXT: whitespaceCharacterInTableText(this, token); } } }; function aaObtainFormattingElementEntry(p, token) { let formattingElementEntry = p.activeFormattingElements.getElementEntryInScopeWithTagName(token.tagName); if (formattingElementEntry) { if (!p.openElements.contains(formattingElementEntry.element)) { p.activeFormattingElements.removeEntry(formattingElementEntry); formattingElementEntry = null; } else if (!p.openElements.hasInScope(token.tagID, formattingElementEntry.element)) formattingElementEntry = null; } else genericEndTagInBody(p, token); return formattingElementEntry; } function aaObtainFurthestBlock(p, formattingElementEntry) { const { openElements } = p; const formattingIdx = openElements._indexOf(formattingElementEntry.element); for (let idx = openElements.slotAbove(formattingIdx); idx !== -1; idx = openElements.slotAbove(idx)) if (p._isSpecialElement(openElements.items[idx], openElements.tagIDs[idx])) return idx; openElements.shortenToLength(formattingIdx); p.activeFormattingElements.removeEntry(formattingElementEntry); return -1; } function aaInnerLoop(p, furthestBlockIdx, formattingElement) { const furthestBlock = p.openElements.items[furthestBlockIdx]; let lastElement = furthestBlock; let nextIdx = p.openElements.slotBelow(furthestBlockIdx); const intendedParent = p.openElements.getCommonAncestor(formattingElement); for (let i = 0, idx = nextIdx; p.openElements.items[idx] !== formattingElement; i++, idx = nextIdx) { let element = p.openElements.items[idx]; nextIdx = p.openElements.slotBelow(idx); const elementEntry = p.activeFormattingElements.getElementEntry(element); const counterOverflow = elementEntry && i >= AA_INNER_LOOP_ITER; if (!elementEntry || counterOverflow) { if (counterOverflow) p.activeFormattingElements.removeEntry(elementEntry); p.openElements.removeAt(idx); } else { element = aaRecreateElementFromEntry(p, elementEntry, intendedParent); if (lastElement === furthestBlock) p.activeFormattingElements.bookmark = elementEntry; p.treeAdapter.detachNode(lastElement); p.treeAdapter.appendChild(element, lastElement); lastElement = element; } } return lastElement; } function aaRecreateElementFromEntry(p, elementEntry, intendedParent) { const ns = p.treeAdapter.getNamespaceURI(elementEntry.element); const newElement = p._createElement(elementEntry.token.tagName, ns, elementEntry.token.attrs, intendedParent); p.openElements.replace(elementEntry.element, newElement); p.activeFormattingElements.replaceElement(elementEntry, newElement); return newElement; } function aaInsertLastNodeInCommonAncestor(p, commonAncestor, lastElement) { const tid = getTagID(p.treeAdapter.getTagName(commonAncestor)); if (p._isElementCausesFosterParenting(tid)) p._fosterParentElement(lastElement); else { const ns = p.treeAdapter.getNamespaceURI(commonAncestor); if (tid === TAG_ID.TEMPLATE && ns === NS.HTML) commonAncestor = p.treeAdapter.getTemplateContent(commonAncestor); p.treeAdapter.appendChild(commonAncestor, lastElement); } } function aaReplaceFormattingElement(p, furthestBlock, formattingElementEntry) { const ns = p.treeAdapter.getNamespaceURI(formattingElementEntry.element); const { token } = formattingElementEntry; const newElement = p._createElement(token.tagName, ns, token.attrs, furthestBlock); p._adoptNodes(furthestBlock, newElement); p.treeAdapter.appendChild(furthestBlock, newElement); p.activeFormattingElements.insertElementAfterBookmark(newElement, token); p.activeFormattingElements.removeEntry(formattingElementEntry); const formattingIdx = p.openElements._indexOf(formattingElementEntry.element); let furthestBlockIdx = p.openElements.slotAbove(formattingIdx); while (p.openElements.items[furthestBlockIdx] !== furthestBlock) furthestBlockIdx = p.openElements.slotAbove(furthestBlockIdx); p.openElements.replaceFormattingElement(formattingIdx, furthestBlockIdx, newElement, token.tagID); } function callAdoptionAgency(p, token) { const { current, currentTagId } = p.openElements; if (currentTagId === token.tagID && p.treeAdapter.getNamespaceURI(current) === NS.HTML && !p.activeFormattingElements.getElementEntry(current)) { p.openElements.pop(); return; } for (let i = 0; i < AA_OUTER_LOOP_ITER; i++) { const formattingElementEntry = aaObtainFormattingElementEntry(p, token); if (!formattingElementEntry) break; const furthestBlockIdx = aaObtainFurthestBlock(p, formattingElementEntry); if (furthestBlockIdx === -1) break; const furthestBlock = p.openElements.items[furthestBlockIdx]; p.activeFormattingElements.bookmark = formattingElementEntry; const lastElement = aaInnerLoop(p, furthestBlockIdx, formattingElementEntry.element); const commonAncestor = p.openElements.getCommonAncestor(formattingElementEntry.element); p.treeAdapter.detachNode(lastElement); if (commonAncestor) aaInsertLastNodeInCommonAncestor(p, commonAncestor, lastElement); aaReplaceFormattingElement(p, furthestBlock, formattingElementEntry); } } function appendComment(p, token) { p._appendCommentNode(token, p.openElements.currentTmplContentOrNode); } function appendCommentToRootHtmlElement(p, token) { p._appendCommentNode(token, p.openElements.items[0]); } function appendCommentToDocument(p, token) { p._appendCommentNode(token, p.document); } function stopParsing(p, token) { p.stopped = true; if (token.location) { const target = p.fragmentContext ? 0 : 2; for (let i = p.openElements.stackTop; i >= target; i = p.openElements.slotBelow(i)) p._setEndLocation(p.openElements.items[i], token); if (!p.fragmentContext && p.openElements.stackTop >= 0) { const htmlElement = p.openElements.items[0]; const htmlLocation = p.treeAdapter.getNodeSourceCodeLocation(htmlElement); if (htmlLocation && !htmlLocation.endTag) { p._setEndLocation(htmlElement, token); if (p.openElements.stackTop >= 1) { const bodyElement = p.openElements.items[1]; const bodyLocation = p.treeAdapter.getNodeSourceCodeLocation(bodyElement); if (bodyLocation && !bodyLocation.endTag) p._setEndLocation(bodyElement, token); } } } } } function doctypeInInitialMode(p, token) { p._setDocumentType(token); const mode = token.forceQuirks ? DOCUMENT_MODE.QUIRKS : getDocumentMode(token); if (!isConforming(token)) p._err(token, ERR.nonConformingDoctype); p.treeAdapter.setDocumentMode(p.document, mode); p.insertionMode = InsertionMode.BEFORE_HTML; } function tokenInInitialMode(p, token) { p._err(token, ERR.missingDoctype, true); p.treeAdapter.setDocumentMode(p.document, DOCUMENT_MODE.QUIRKS); p.insertionMode = InsertionMode.BEFORE_HTML; p._processToken(token); } function startTagBeforeHtml(p, token) { if (token.tagID === TAG_ID.HTML) { p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.BEFORE_HEAD; } else tokenBeforeHtml(p, token); } function endTagBeforeHtml(p, token) { const tn = token.tagID; if (tn === TAG_ID.HTML || tn === TAG_ID.HEAD || tn === TAG_ID.BODY || tn === TAG_ID.BR) tokenBeforeHtml(p, token); } function tokenBeforeHtml(p, token) { p._insertFakeRootElement(); p.insertionMode = InsertionMode.BEFORE_HEAD; p._processToken(token); } function startTagBeforeHead(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.HEAD: p._insertElement(token, NS.HTML); p.headElement = p.openElements.current; p.insertionMode = InsertionMode.IN_HEAD; break; default: tokenBeforeHead(p, token); } } function endTagBeforeHead(p, token) { const tn = token.tagID; if (tn === TAG_ID.HEAD || tn === TAG_ID.BODY || tn === TAG_ID.HTML || tn === TAG_ID.BR) tokenBeforeHead(p, token); else p._err(token, ERR.endTagWithoutMatchingOpenElement); } function tokenBeforeHead(p, token) { p._insertFakeElement(TAG_NAMES.HEAD, TAG_ID.HEAD); p.headElement = p.openElements.current; p.insertionMode = InsertionMode.IN_HEAD; p._processToken(token); } function startTagInHead(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.BASE: case TAG_ID.BASEFONT: case TAG_ID.BGSOUND: case TAG_ID.LINK: case TAG_ID.META: p._appendElement(token, NS.HTML); token.ackSelfClosing = true; break; case TAG_ID.TITLE: p._switchToTextParsing(token, TokenizerMode.RCDATA); break; case TAG_ID.NOSCRIPT: if (p.options.scriptingEnabled) p._switchToTextParsing(token, TokenizerMode.RAWTEXT); else { p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_HEAD_NO_SCRIPT; } break; case TAG_ID.NOFRAMES: case TAG_ID.STYLE: p._switchToTextParsing(token, TokenizerMode.RAWTEXT); break; case TAG_ID.SCRIPT: p._switchToTextParsing(token, TokenizerMode.SCRIPT_DATA); break; case TAG_ID.TEMPLATE: p._insertTemplate(token); p.activeFormattingElements.insertMarker(); p.framesetOk = false; p.insertionMode = InsertionMode.IN_TEMPLATE; p.tmplInsertionModeStack.push(InsertionMode.IN_TEMPLATE); break; case TAG_ID.HEAD: p._err(token, ERR.misplacedStartTagForHeadElement); break; default: tokenInHead(p, token); } } function endTagInHead(p, token) { switch (token.tagID) { case TAG_ID.HEAD: p.openElements.pop(); p.insertionMode = InsertionMode.AFTER_HEAD; break; case TAG_ID.BODY: case TAG_ID.BR: case TAG_ID.HTML: tokenInHead(p, token); break; case TAG_ID.TEMPLATE: templateEndTagInHead(p, token); break; default: p._err(token, ERR.endTagWithoutMatchingOpenElement); } } function templateEndTagInHead(p, token) { if (p.openElements.tmplCount > 0) { p.openElements.generateImpliedEndTagsThoroughly(); if (p.openElements.currentTagId !== TAG_ID.TEMPLATE) p._err(token, ERR.closingOfElementWithOpenChildElements); p.openElements.popUntilTagNamePopped(TAG_ID.TEMPLATE); p.activeFormattingElements.clearToLastMarker(); p.tmplInsertionModeStack.pop(); p._resetInsertionMode(); } else p._err(token, ERR.endTagWithoutMatchingOpenElement); } function tokenInHead(p, token) { p.openElements.pop(); p.insertionMode = InsertionMode.AFTER_HEAD; p._processToken(token); } function startTagInHeadNoScript(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.BASEFONT: case TAG_ID.BGSOUND: case TAG_ID.HEAD: case TAG_ID.LINK: case TAG_ID.META: case TAG_ID.NOFRAMES: case TAG_ID.STYLE: startTagInHead(p, token); break; case TAG_ID.NOSCRIPT: p._err(token, ERR.nestedNoscriptInHead); break; default: tokenInHeadNoScript(p, token); } } function endTagInHeadNoScript(p, token) { switch (token.tagID) { case TAG_ID.NOSCRIPT: p.openElements.pop(); p.insertionMode = InsertionMode.IN_HEAD; break; case TAG_ID.BR: tokenInHeadNoScript(p, token); break; default: p._err(token, ERR.endTagWithoutMatchingOpenElement); } } function tokenInHeadNoScript(p, token) { p._err(token, token.type === TokenType.EOF ? ERR.openElementsLeftAfterEof : ERR.disallowedContentInNoscriptInHead); p.openElements.pop(); p.insertionMode = InsertionMode.IN_HEAD; p._processToken(token); } function startTagAfterHead(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.BODY: p._insertElement(token, NS.HTML); p.framesetOk = false; p.insertionMode = InsertionMode.IN_BODY; break; case TAG_ID.FRAMESET: p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_FRAMESET; break; case TAG_ID.BASE: case TAG_ID.BASEFONT: case TAG_ID.BGSOUND: case TAG_ID.LINK: case TAG_ID.META: case TAG_ID.NOFRAMES: case TAG_ID.SCRIPT: case TAG_ID.STYLE: case TAG_ID.TEMPLATE: case TAG_ID.TITLE: p._err(token, ERR.abandonedHeadElementChild); p.openElements.push(p.headElement, TAG_ID.HEAD); startTagInHead(p, token); p.openElements.remove(p.headElement); break; case TAG_ID.HEAD: p._err(token, ERR.misplacedStartTagForHeadElement); break; default: tokenAfterHead(p, token); } } function endTagAfterHead(p, token) { switch (token.tagID) { case TAG_ID.BODY: case TAG_ID.HTML: case TAG_ID.BR: tokenAfterHead(p, token); break; case TAG_ID.TEMPLATE: templateEndTagInHead(p, token); break; default: p._err(token, ERR.endTagWithoutMatchingOpenElement); } } function tokenAfterHead(p, token) { p._insertFakeElement(TAG_NAMES.BODY, TAG_ID.BODY); p.insertionMode = InsertionMode.IN_BODY; modeInBody(p, token); } function modeInBody(p, token) { switch (token.type) { case TokenType.CHARACTER: characterInBody(p, token); break; case TokenType.WHITESPACE_CHARACTER: whitespaceCharacterInBody(p, token); break; case TokenType.COMMENT: appendComment(p, token); break; case TokenType.START_TAG: startTagInBody(p, token); break; case TokenType.END_TAG: endTagInBody(p, token); break; case TokenType.EOF: eofInBody(p, token); } } function whitespaceCharacterInBody(p, token) { p._reconstructActiveFormattingElements(); p._insertCharacters(token); } function characterInBody(p, token) { p._reconstructActiveFormattingElements(); p._insertCharacters(token); p.framesetOk = false; } function htmlStartTagInBody(p, token) { if (p.openElements.tmplCount === 0) p.treeAdapter.adoptAttributes(p.openElements.items[0], token.attrs); } function bodyStartTagInBody(p, token) { const bodyElement = p.openElements.tryPeekProperlyNestedBodyElement(); if (bodyElement && p.openElements.tmplCount === 0) { p.framesetOk = false; p.treeAdapter.adoptAttributes(bodyElement, token.attrs); } } function framesetStartTagInBody(p, token) { const bodyElement = p.openElements.tryPeekProperlyNestedBodyElement(); if (p.framesetOk && bodyElement) { p.treeAdapter.detachNode(bodyElement); p.openElements.popAllUpToHtmlElement(); p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_FRAMESET; } } function addressStartTagInBody(p, token) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._insertElement(token, NS.HTML); } function numberedHeaderStartTagInBody(p, token) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); if (p.openElements.currentTagId !== void 0 && NUMBERED_HEADERS$1.has(p.openElements.currentTagId)) p.openElements.pop(); p._insertElement(token, NS.HTML); } function preStartTagInBody(p, token) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._insertElement(token, NS.HTML); p.skipNextNewLine = true; p.framesetOk = false; } function formStartTagInBody(p, token) { const inTemplate = p.openElements.tmplCount > 0; if (!p.formElement || inTemplate) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._insertElement(token, NS.HTML); if (!inTemplate) p.formElement = p.openElements.current; } } function listItemStartTagInBody(p, token) { p.framesetOk = false; const idx = token.tagID === TAG_ID.LI ? p.openElements.indexOfTopmost(TAG_ID.LI) : Math.max(p.openElements.indexOfTopmost(TAG_ID.DD), p.openElements.indexOfTopmost(TAG_ID.DT)); if (idx !== -1 && !p.openElements.hasListItemBoundaryAbove(idx)) { const elementId = p.openElements.tagIDs[idx]; p.openElements.generateImpliedEndTagsWithExclusion(elementId); p.openElements.popUntilTagNamePopped(elementId); } if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._insertElement(token, NS.HTML); } function plaintextStartTagInBody(p, token) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._insertElement(token, NS.HTML); p.tokenizer.state = TokenizerMode.PLAINTEXT; } function buttonStartTagInBody(p, token) { if (p.openElements.hasInScope(TAG_ID.BUTTON)) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilTagNamePopped(TAG_ID.BUTTON); } p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); p.framesetOk = false; } function aStartTagInBody(p, token) { const activeElementEntry = p.activeFormattingElements.getElementEntryInScopeWithTagName(TAG_NAMES.A); if (activeElementEntry) { callAdoptionAgency(p, token); p.openElements.remove(activeElementEntry.element); p.activeFormattingElements.removeEntry(activeElementEntry); } p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); p.activeFormattingElements.pushElement(p.openElements.current, token); } function bStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); p.activeFormattingElements.pushElement(p.openElements.current, token); } function nobrStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); if (p.openElements.hasInScope(TAG_ID.NOBR)) { callAdoptionAgency(p, token); p._reconstructActiveFormattingElements(); } p._insertElement(token, NS.HTML); p.activeFormattingElements.pushElement(p.openElements.current, token); } function appletStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); p.activeFormattingElements.insertMarker(); p.framesetOk = false; } function tableStartTagInBody(p, token) { if (p.treeAdapter.getDocumentMode(p.document) !== DOCUMENT_MODE.QUIRKS && p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._insertElement(token, NS.HTML); p.framesetOk = false; p.insertionMode = InsertionMode.IN_TABLE; } function areaStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); p._appendElement(token, NS.HTML); p.framesetOk = false; token.ackSelfClosing = true; } function isHiddenInput(token) { const inputType = getTokenAttr(token, ATTRS.TYPE); return inputType != null && inputType.toLowerCase() === HIDDEN_INPUT_TYPE; } function inputStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); p._appendElement(token, NS.HTML); if (!isHiddenInput(token)) p.framesetOk = false; token.ackSelfClosing = true; } function paramStartTagInBody(p, token) { p._appendElement(token, NS.HTML); token.ackSelfClosing = true; } function hrStartTagInBody(p, token) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._appendElement(token, NS.HTML); p.framesetOk = false; token.ackSelfClosing = true; } function imageStartTagInBody(p, token) { token.tagName = TAG_NAMES.IMG; token.tagID = TAG_ID.IMG; areaStartTagInBody(p, token); } function textareaStartTagInBody(p, token) { p._insertElement(token, NS.HTML); p.skipNextNewLine = true; p.tokenizer.state = TokenizerMode.RCDATA; p.originalInsertionMode = p.insertionMode; p.framesetOk = false; p.insertionMode = InsertionMode.TEXT; } function xmpStartTagInBody(p, token) { if (p.openElements.hasInButtonScope(TAG_ID.P)) p._closePElement(); p._reconstructActiveFormattingElements(); p.framesetOk = false; p._switchToTextParsing(token, TokenizerMode.RAWTEXT); } function iframeStartTagInBody(p, token) { p.framesetOk = false; p._switchToTextParsing(token, TokenizerMode.RAWTEXT); } function rawTextStartTagInBody(p, token) { p._switchToTextParsing(token, TokenizerMode.RAWTEXT); } function selectStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); p.framesetOk = false; p.insertionMode = p.insertionMode === InsertionMode.IN_TABLE || p.insertionMode === InsertionMode.IN_CAPTION || p.insertionMode === InsertionMode.IN_TABLE_BODY || p.insertionMode === InsertionMode.IN_ROW || p.insertionMode === InsertionMode.IN_CELL ? InsertionMode.IN_SELECT_IN_TABLE : InsertionMode.IN_SELECT; } function optgroupStartTagInBody(p, token) { if (p.openElements.currentTagId === TAG_ID.OPTION) p.openElements.pop(); p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); } function rbStartTagInBody(p, token) { if (p.openElements.hasInScope(TAG_ID.RUBY)) p.openElements.generateImpliedEndTags(); p._insertElement(token, NS.HTML); } function rtStartTagInBody(p, token) { if (p.openElements.hasInScope(TAG_ID.RUBY)) p.openElements.generateImpliedEndTagsWithExclusion(TAG_ID.RTC); p._insertElement(token, NS.HTML); } function mathStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); adjustTokenMathMLAttrs(token); adjustTokenXMLAttrs(token); if (token.selfClosing) p._appendElement(token, NS.MATHML); else p._insertElement(token, NS.MATHML); token.ackSelfClosing = true; } function svgStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); adjustTokenSVGAttrs(token); adjustTokenXMLAttrs(token); if (token.selfClosing) p._appendElement(token, NS.SVG); else p._insertElement(token, NS.SVG); token.ackSelfClosing = true; } function genericStartTagInBody(p, token) { p._reconstructActiveFormattingElements(); p._insertElement(token, NS.HTML); } function startTagInBody(p, token) { switch (token.tagID) { case TAG_ID.I: case TAG_ID.S: case TAG_ID.B: case TAG_ID.U: case TAG_ID.EM: case TAG_ID.TT: case TAG_ID.BIG: case TAG_ID.CODE: case TAG_ID.FONT: case TAG_ID.SMALL: case TAG_ID.STRIKE: case TAG_ID.STRONG: bStartTagInBody(p, token); break; case TAG_ID.A: aStartTagInBody(p, token); break; case TAG_ID.H1: case TAG_ID.H2: case TAG_ID.H3: case TAG_ID.H4: case TAG_ID.H5: case TAG_ID.H6: numberedHeaderStartTagInBody(p, token); break; case TAG_ID.P: case TAG_ID.DL: case TAG_ID.OL: case TAG_ID.UL: case TAG_ID.DIV: case TAG_ID.DIR: case TAG_ID.NAV: case TAG_ID.MAIN: case TAG_ID.MENU: case TAG_ID.ASIDE: case TAG_ID.CENTER: case TAG_ID.FIGURE: case TAG_ID.FOOTER: case TAG_ID.HEADER: case TAG_ID.HGROUP: case TAG_ID.DIALOG: case TAG_ID.DETAILS: case TAG_ID.ADDRESS: case TAG_ID.ARTICLE: case TAG_ID.SEARCH: case TAG_ID.SECTION: case TAG_ID.SUMMARY: case TAG_ID.FIELDSET: case TAG_ID.BLOCKQUOTE: case TAG_ID.FIGCAPTION: addressStartTagInBody(p, token); break; case TAG_ID.LI: case TAG_ID.DD: case TAG_ID.DT: listItemStartTagInBody(p, token); break; case TAG_ID.BR: case TAG_ID.IMG: case TAG_ID.WBR: case TAG_ID.AREA: case TAG_ID.EMBED: case TAG_ID.KEYGEN: areaStartTagInBody(p, token); break; case TAG_ID.HR: hrStartTagInBody(p, token); break; case TAG_ID.RB: case TAG_ID.RTC: rbStartTagInBody(p, token); break; case TAG_ID.RT: case TAG_ID.RP: rtStartTagInBody(p, token); break; case TAG_ID.PRE: case TAG_ID.LISTING: preStartTagInBody(p, token); break; case TAG_ID.XMP: xmpStartTagInBody(p, token); break; case TAG_ID.SVG: svgStartTagInBody(p, token); break; case TAG_ID.HTML: htmlStartTagInBody(p, token); break; case TAG_ID.BASE: case TAG_ID.LINK: case TAG_ID.META: case TAG_ID.STYLE: case TAG_ID.TITLE: case TAG_ID.SCRIPT: case TAG_ID.BGSOUND: case TAG_ID.BASEFONT: case TAG_ID.TEMPLATE: startTagInHead(p, token); break; case TAG_ID.BODY: bodyStartTagInBody(p, token); break; case TAG_ID.FORM: formStartTagInBody(p, token); break; case TAG_ID.NOBR: nobrStartTagInBody(p, token); break; case TAG_ID.MATH: mathStartTagInBody(p, token); break; case TAG_ID.TABLE: tableStartTagInBody(p, token); break; case TAG_ID.INPUT: inputStartTagInBody(p, token); break; case TAG_ID.PARAM: case TAG_ID.TRACK: case TAG_ID.SOURCE: paramStartTagInBody(p, token); break; case TAG_ID.IMAGE: imageStartTagInBody(p, token); break; case TAG_ID.BUTTON: buttonStartTagInBody(p, token); break; case TAG_ID.APPLET: case TAG_ID.OBJECT: case TAG_ID.MARQUEE: appletStartTagInBody(p, token); break; case TAG_ID.IFRAME: iframeStartTagInBody(p, token); break; case TAG_ID.SELECT: selectStartTagInBody(p, token); break; case TAG_ID.OPTION: case TAG_ID.OPTGROUP: optgroupStartTagInBody(p, token); break; case TAG_ID.NOEMBED: case TAG_ID.NOFRAMES: rawTextStartTagInBody(p, token); break; case TAG_ID.FRAMESET: framesetStartTagInBody(p, token); break; case TAG_ID.TEXTAREA: textareaStartTagInBody(p, token); break; case TAG_ID.NOSCRIPT: if (p.options.scriptingEnabled) rawTextStartTagInBody(p, token); else genericStartTagInBody(p, token); break; case TAG_ID.PLAINTEXT: plaintextStartTagInBody(p, token); break; case TAG_ID.COL: case TAG_ID.TH: case TAG_ID.TD: case TAG_ID.TR: case TAG_ID.HEAD: case TAG_ID.FRAME: case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: case TAG_ID.CAPTION: case TAG_ID.COLGROUP: break; default: genericStartTagInBody(p, token); } } function bodyEndTagInBody(p, token) { if (p.openElements.hasInScope(TAG_ID.BODY)) { p.insertionMode = InsertionMode.AFTER_BODY; if (p.options.sourceCodeLocationInfo) { const bodyElement = p.openElements.tryPeekProperlyNestedBodyElement(); if (bodyElement) p._setEndLocation(bodyElement, token); } } } function htmlEndTagInBody(p, token) { if (p.openElements.hasInScope(TAG_ID.BODY)) { p.insertionMode = InsertionMode.AFTER_BODY; endTagAfterBody(p, token); } } function addressEndTagInBody(p, token) { const tn = token.tagID; if (p.openElements.hasInScope(tn)) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilTagNamePopped(tn); } } function formEndTagInBody(p) { const inTemplate = p.openElements.tmplCount > 0; const { formElement } = p; if (!inTemplate) p.formElement = null; if ((formElement || inTemplate) && p.openElements.hasInScope(TAG_ID.FORM)) { p.openElements.generateImpliedEndTags(); if (inTemplate) p.openElements.popUntilTagNamePopped(TAG_ID.FORM); else if (formElement) p.openElements.remove(formElement); } } function pEndTagInBody(p) { if (!p.openElements.hasInButtonScope(TAG_ID.P)) p._insertFakeElement(TAG_NAMES.P, TAG_ID.P); p._closePElement(); } function liEndTagInBody(p) { if (p.openElements.hasInListItemScope(TAG_ID.LI)) { p.openElements.generateImpliedEndTagsWithExclusion(TAG_ID.LI); p.openElements.popUntilTagNamePopped(TAG_ID.LI); } } function ddEndTagInBody(p, token) { const tn = token.tagID; if (p.openElements.hasInScope(tn)) { p.openElements.generateImpliedEndTagsWithExclusion(tn); p.openElements.popUntilTagNamePopped(tn); } } function numberedHeaderEndTagInBody(p) { if (p.openElements.hasNumberedHeaderInScope()) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilNumberedHeaderPopped(); } } function appletEndTagInBody(p, token) { const tn = token.tagID; if (p.openElements.hasInScope(tn)) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilTagNamePopped(tn); p.activeFormattingElements.clearToLastMarker(); } } function brEndTagInBody(p) { p._reconstructActiveFormattingElements(); p._insertFakeElement(TAG_NAMES.BR, TAG_ID.BR); p.openElements.pop(); p.framesetOk = false; } function genericEndTagInBody(p, token) { const tid = token.tagID; const i = tid === TAG_ID.UNKNOWN ? p.openElements.indexOfTopmostByName(NS.HTML, token.tagName) : p.openElements.indexOfTopmost(tid); if (i > 0 && !p.openElements.hasSpecialElementAbove(i)) { p.openElements.generateImpliedEndTagsWithExclusion(tid); if (p.openElements.stackTop >= i) p.openElements.shortenToLength(i); } } function endTagInBody(p, token) { switch (token.tagID) { case TAG_ID.A: case TAG_ID.B: case TAG_ID.I: case TAG_ID.S: case TAG_ID.U: case TAG_ID.EM: case TAG_ID.TT: case TAG_ID.BIG: case TAG_ID.CODE: case TAG_ID.FONT: case TAG_ID.NOBR: case TAG_ID.SMALL: case TAG_ID.STRIKE: case TAG_ID.STRONG: callAdoptionAgency(p, token); break; case TAG_ID.P: pEndTagInBody(p); break; case TAG_ID.DL: case TAG_ID.UL: case TAG_ID.OL: case TAG_ID.DIR: case TAG_ID.DIV: case TAG_ID.NAV: case TAG_ID.PRE: case TAG_ID.MAIN: case TAG_ID.MENU: case TAG_ID.ASIDE: case TAG_ID.BUTTON: case TAG_ID.CENTER: case TAG_ID.FIGURE: case TAG_ID.FOOTER: case TAG_ID.HEADER: case TAG_ID.HGROUP: case TAG_ID.DIALOG: case TAG_ID.ADDRESS: case TAG_ID.ARTICLE: case TAG_ID.DETAILS: case TAG_ID.SEARCH: case TAG_ID.SECTION: case TAG_ID.SUMMARY: case TAG_ID.LISTING: case TAG_ID.FIELDSET: case TAG_ID.BLOCKQUOTE: case TAG_ID.FIGCAPTION: addressEndTagInBody(p, token); break; case TAG_ID.LI: liEndTagInBody(p); break; case TAG_ID.DD: case TAG_ID.DT: ddEndTagInBody(p, token); break; case TAG_ID.H1: case TAG_ID.H2: case TAG_ID.H3: case TAG_ID.H4: case TAG_ID.H5: case TAG_ID.H6: numberedHeaderEndTagInBody(p); break; case TAG_ID.BR: brEndTagInBody(p); break; case TAG_ID.BODY: bodyEndTagInBody(p, token); break; case TAG_ID.HTML: htmlEndTagInBody(p, token); break; case TAG_ID.FORM: formEndTagInBody(p); break; case TAG_ID.APPLET: case TAG_ID.OBJECT: case TAG_ID.MARQUEE: appletEndTagInBody(p, token); break; case TAG_ID.TEMPLATE: templateEndTagInHead(p, token); break; default: genericEndTagInBody(p, token); } } function eofInBody(p, token) { if (p.tmplInsertionModeStack.length > 0) eofInTemplate(p, token); else stopParsing(p, token); } function endTagInText(p, token) { var _a; if (token.tagID === TAG_ID.SCRIPT) (_a = p.scriptHandler) === null || _a === void 0 || _a.call(p, p.openElements.current); p.openElements.pop(); p.insertionMode = p.originalInsertionMode; } function eofInText(p, token) { p._err(token, ERR.eofInElementThatCanContainOnlyText); p.openElements.pop(); p.insertionMode = p.originalInsertionMode; p.onEof(token); } function characterInTable(p, token) { if (p.openElements.currentTagId !== void 0 && TABLE_STRUCTURE_TAGS.has(p.openElements.currentTagId)) { p.pendingCharacterTokens.length = 0; p.hasNonWhitespacePendingCharacterToken = false; p.originalInsertionMode = p.insertionMode; p.insertionMode = InsertionMode.IN_TABLE_TEXT; switch (token.type) { case TokenType.CHARACTER: characterInTableText(p, token); break; case TokenType.WHITESPACE_CHARACTER: whitespaceCharacterInTableText(p, token); } } else tokenInTable(p, token); } function captionStartTagInTable(p, token) { p.openElements.clearBackToTableContext(); p.activeFormattingElements.insertMarker(); p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_CAPTION; } function colgroupStartTagInTable(p, token) { p.openElements.clearBackToTableContext(); p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_COLUMN_GROUP; } function colStartTagInTable(p, token) { p.openElements.clearBackToTableContext(); p._insertFakeElement(TAG_NAMES.COLGROUP, TAG_ID.COLGROUP); p.insertionMode = InsertionMode.IN_COLUMN_GROUP; startTagInColumnGroup(p, token); } function tbodyStartTagInTable(p, token) { p.openElements.clearBackToTableContext(); p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_TABLE_BODY; } function tdStartTagInTable(p, token) { p.openElements.clearBackToTableContext(); p._insertFakeElement(TAG_NAMES.TBODY, TAG_ID.TBODY); p.insertionMode = InsertionMode.IN_TABLE_BODY; startTagInTableBody(p, token); } function tableStartTagInTable(p, token) { if (p.openElements.hasInTableScope(TAG_ID.TABLE)) { p.openElements.popUntilTagNamePopped(TAG_ID.TABLE); p._resetInsertionMode(); p._processStartTag(token); } } function inputStartTagInTable(p, token) { if (isHiddenInput(token)) p._appendElement(token, NS.HTML); else tokenInTable(p, token); token.ackSelfClosing = true; } function formStartTagInTable(p, token) { if (!p.formElement && p.openElements.tmplCount === 0) { p._insertElement(token, NS.HTML); p.formElement = p.openElements.current; p.openElements.pop(); } } function startTagInTable(p, token) { switch (token.tagID) { case TAG_ID.TD: case TAG_ID.TH: case TAG_ID.TR: tdStartTagInTable(p, token); break; case TAG_ID.STYLE: case TAG_ID.SCRIPT: case TAG_ID.TEMPLATE: startTagInHead(p, token); break; case TAG_ID.COL: colStartTagInTable(p, token); break; case TAG_ID.FORM: formStartTagInTable(p, token); break; case TAG_ID.TABLE: tableStartTagInTable(p, token); break; case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: tbodyStartTagInTable(p, token); break; case TAG_ID.INPUT: inputStartTagInTable(p, token); break; case TAG_ID.CAPTION: captionStartTagInTable(p, token); break; case TAG_ID.COLGROUP: colgroupStartTagInTable(p, token); break; default: tokenInTable(p, token); } } function endTagInTable(p, token) { switch (token.tagID) { case TAG_ID.TABLE: if (p.openElements.hasInTableScope(TAG_ID.TABLE)) { p.openElements.popUntilTagNamePopped(TAG_ID.TABLE); p._resetInsertionMode(); } break; case TAG_ID.TEMPLATE: templateEndTagInHead(p, token); break; case TAG_ID.BODY: case TAG_ID.CAPTION: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.HTML: case TAG_ID.TBODY: case TAG_ID.TD: case TAG_ID.TFOOT: case TAG_ID.TH: case TAG_ID.THEAD: case TAG_ID.TR: break; default: tokenInTable(p, token); } } function tokenInTable(p, token) { const savedFosterParentingState = p.fosterParentingEnabled; p.fosterParentingEnabled = true; modeInBody(p, token); p.fosterParentingEnabled = savedFosterParentingState; } function whitespaceCharacterInTableText(p, token) { p.pendingCharacterTokens.push(token); } function characterInTableText(p, token) { p.pendingCharacterTokens.push(token); p.hasNonWhitespacePendingCharacterToken = true; } function tokenInTableText(p, token) { let i = 0; if (p.hasNonWhitespacePendingCharacterToken) for (; i < p.pendingCharacterTokens.length; i++) tokenInTable(p, p.pendingCharacterTokens[i]); else for (; i < p.pendingCharacterTokens.length; i++) p._insertCharacters(p.pendingCharacterTokens[i]); p.insertionMode = p.originalInsertionMode; p._processToken(token); } const TABLE_VOID_ELEMENTS = /* @__PURE__ */ new Set([ TAG_ID.CAPTION, TAG_ID.COL, TAG_ID.COLGROUP, TAG_ID.TBODY, TAG_ID.TD, TAG_ID.TFOOT, TAG_ID.TH, TAG_ID.THEAD, TAG_ID.TR ]); function startTagInCaption(p, token) { if (TABLE_VOID_ELEMENTS.has(token.tagID)) { if (p.openElements.hasInTableScope(TAG_ID.CAPTION)) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilTagNamePopped(TAG_ID.CAPTION); p.activeFormattingElements.clearToLastMarker(); p.insertionMode = InsertionMode.IN_TABLE; startTagInTable(p, token); } } else startTagInBody(p, token); } function endTagInCaption(p, token) { const tn = token.tagID; switch (tn) { case TAG_ID.CAPTION: case TAG_ID.TABLE: if (p.openElements.hasInTableScope(TAG_ID.CAPTION)) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilTagNamePopped(TAG_ID.CAPTION); p.activeFormattingElements.clearToLastMarker(); p.insertionMode = InsertionMode.IN_TABLE; if (tn === TAG_ID.TABLE) endTagInTable(p, token); } break; case TAG_ID.BODY: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.HTML: case TAG_ID.TBODY: case TAG_ID.TD: case TAG_ID.TFOOT: case TAG_ID.TH: case TAG_ID.THEAD: case TAG_ID.TR: break; default: endTagInBody(p, token); } } function startTagInColumnGroup(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.COL: p._appendElement(token, NS.HTML); token.ackSelfClosing = true; break; case TAG_ID.TEMPLATE: startTagInHead(p, token); break; default: tokenInColumnGroup(p, token); } } function endTagInColumnGroup(p, token) { switch (token.tagID) { case TAG_ID.COLGROUP: if (p.openElements.currentTagId === TAG_ID.COLGROUP) { p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE; } break; case TAG_ID.TEMPLATE: templateEndTagInHead(p, token); break; case TAG_ID.COL: break; default: tokenInColumnGroup(p, token); } } function tokenInColumnGroup(p, token) { if (p.openElements.currentTagId === TAG_ID.COLGROUP) { p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE; p._processToken(token); } } function startTagInTableBody(p, token) { switch (token.tagID) { case TAG_ID.TR: p.openElements.clearBackToTableBodyContext(); p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_ROW; break; case TAG_ID.TH: case TAG_ID.TD: p.openElements.clearBackToTableBodyContext(); p._insertFakeElement(TAG_NAMES.TR, TAG_ID.TR); p.insertionMode = InsertionMode.IN_ROW; startTagInRow(p, token); break; case TAG_ID.CAPTION: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: if (p.openElements.hasTableBodyContextInTableScope()) { p.openElements.clearBackToTableBodyContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE; startTagInTable(p, token); } break; default: startTagInTable(p, token); } } function endTagInTableBody(p, token) { const tn = token.tagID; switch (token.tagID) { case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: if (p.openElements.hasInTableScope(tn)) { p.openElements.clearBackToTableBodyContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE; } break; case TAG_ID.TABLE: if (p.openElements.hasTableBodyContextInTableScope()) { p.openElements.clearBackToTableBodyContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE; endTagInTable(p, token); } break; case TAG_ID.BODY: case TAG_ID.CAPTION: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.HTML: case TAG_ID.TD: case TAG_ID.TH: case TAG_ID.TR: break; default: endTagInTable(p, token); } } function startTagInRow(p, token) { switch (token.tagID) { case TAG_ID.TH: case TAG_ID.TD: p.openElements.clearBackToTableRowContext(); p._insertElement(token, NS.HTML); p.insertionMode = InsertionMode.IN_CELL; p.activeFormattingElements.insertMarker(); break; case TAG_ID.CAPTION: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: case TAG_ID.TR: if (p.openElements.hasInTableScope(TAG_ID.TR)) { p.openElements.clearBackToTableRowContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE_BODY; startTagInTableBody(p, token); } break; default: startTagInTable(p, token); } } function endTagInRow(p, token) { switch (token.tagID) { case TAG_ID.TR: if (p.openElements.hasInTableScope(TAG_ID.TR)) { p.openElements.clearBackToTableRowContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE_BODY; } break; case TAG_ID.TABLE: if (p.openElements.hasInTableScope(TAG_ID.TR)) { p.openElements.clearBackToTableRowContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE_BODY; endTagInTableBody(p, token); } break; case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: if (p.openElements.hasInTableScope(token.tagID) || p.openElements.hasInTableScope(TAG_ID.TR)) { p.openElements.clearBackToTableRowContext(); p.openElements.pop(); p.insertionMode = InsertionMode.IN_TABLE_BODY; endTagInTableBody(p, token); } break; case TAG_ID.BODY: case TAG_ID.CAPTION: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.HTML: case TAG_ID.TD: case TAG_ID.TH: break; default: endTagInTable(p, token); } } function startTagInCell(p, token) { if (TABLE_VOID_ELEMENTS.has(token.tagID)) { if (p.openElements.hasInTableScope(TAG_ID.TD) || p.openElements.hasInTableScope(TAG_ID.TH)) { p._closeTableCell(); startTagInRow(p, token); } } else startTagInBody(p, token); } function endTagInCell(p, token) { const tn = token.tagID; switch (tn) { case TAG_ID.TD: case TAG_ID.TH: if (p.openElements.hasInTableScope(tn)) { p.openElements.generateImpliedEndTags(); p.openElements.popUntilTagNamePopped(tn); p.activeFormattingElements.clearToLastMarker(); p.insertionMode = InsertionMode.IN_ROW; } break; case TAG_ID.TABLE: case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: case TAG_ID.TR: if (p.openElements.hasInTableScope(tn)) { p._closeTableCell(); endTagInRow(p, token); } break; case TAG_ID.BODY: case TAG_ID.CAPTION: case TAG_ID.COL: case TAG_ID.COLGROUP: case TAG_ID.HTML: break; default: endTagInBody(p, token); } } function startTagInSelect(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.OPTION: if (p.openElements.currentTagId === TAG_ID.OPTION) p.openElements.pop(); p._insertElement(token, NS.HTML); break; case TAG_ID.OPTGROUP: if (p.openElements.currentTagId === TAG_ID.OPTION) p.openElements.pop(); if (p.openElements.currentTagId === TAG_ID.OPTGROUP) p.openElements.pop(); p._insertElement(token, NS.HTML); break; case TAG_ID.HR: if (p.openElements.currentTagId === TAG_ID.OPTION) p.openElements.pop(); if (p.openElements.currentTagId === TAG_ID.OPTGROUP) p.openElements.pop(); p._appendElement(token, NS.HTML); token.ackSelfClosing = true; break; case TAG_ID.INPUT: case TAG_ID.KEYGEN: case TAG_ID.TEXTAREA: case TAG_ID.SELECT: if (p.openElements.hasInSelectScope(TAG_ID.SELECT)) { p.openElements.popUntilTagNamePopped(TAG_ID.SELECT); p._resetInsertionMode(); if (token.tagID !== TAG_ID.SELECT) p._processStartTag(token); } break; case TAG_ID.SCRIPT: case TAG_ID.TEMPLATE: startTagInHead(p, token); } } function endTagInSelect(p, token) { switch (token.tagID) { case TAG_ID.OPTGROUP: if (p.openElements.stackTop > 0 && p.openElements.currentTagId === TAG_ID.OPTION && p.openElements.tagIDs[p.openElements.slotBelow(p.openElements.stackTop)] === TAG_ID.OPTGROUP) p.openElements.pop(); if (p.openElements.currentTagId === TAG_ID.OPTGROUP) p.openElements.pop(); break; case TAG_ID.OPTION: if (p.openElements.currentTagId === TAG_ID.OPTION) p.openElements.pop(); break; case TAG_ID.SELECT: if (p.openElements.hasInSelectScope(TAG_ID.SELECT)) { p.openElements.popUntilTagNamePopped(TAG_ID.SELECT); p._resetInsertionMode(); } break; case TAG_ID.TEMPLATE: templateEndTagInHead(p, token); } } function startTagInSelectInTable(p, token) { const tn = token.tagID; if (tn === TAG_ID.CAPTION || tn === TAG_ID.TABLE || tn === TAG_ID.TBODY || tn === TAG_ID.TFOOT || tn === TAG_ID.THEAD || tn === TAG_ID.TR || tn === TAG_ID.TD || tn === TAG_ID.TH) { p.openElements.popUntilTagNamePopped(TAG_ID.SELECT); p._resetInsertionMode(); p._processStartTag(token); } else startTagInSelect(p, token); } function endTagInSelectInTable(p, token) { const tn = token.tagID; if (tn === TAG_ID.CAPTION || tn === TAG_ID.TABLE || tn === TAG_ID.TBODY || tn === TAG_ID.TFOOT || tn === TAG_ID.THEAD || tn === TAG_ID.TR || tn === TAG_ID.TD || tn === TAG_ID.TH) { if (p.openElements.hasInTableScope(tn)) { p.openElements.popUntilTagNamePopped(TAG_ID.SELECT); p._resetInsertionMode(); p.onEndTag(token); } } else endTagInSelect(p, token); } function startTagInTemplate(p, token) { switch (token.tagID) { case TAG_ID.BASE: case TAG_ID.BASEFONT: case TAG_ID.BGSOUND: case TAG_ID.LINK: case TAG_ID.META: case TAG_ID.NOFRAMES: case TAG_ID.SCRIPT: case TAG_ID.STYLE: case TAG_ID.TEMPLATE: case TAG_ID.TITLE: startTagInHead(p, token); break; case TAG_ID.CAPTION: case TAG_ID.COLGROUP: case TAG_ID.TBODY: case TAG_ID.TFOOT: case TAG_ID.THEAD: p.tmplInsertionModeStack[p.tmplInsertionModeStack.length - 1] = InsertionMode.IN_TABLE; p.insertionMode = InsertionMode.IN_TABLE; startTagInTable(p, token); break; case TAG_ID.COL: p.tmplInsertionModeStack[p.tmplInsertionModeStack.length - 1] = InsertionMode.IN_COLUMN_GROUP; p.insertionMode = InsertionMode.IN_COLUMN_GROUP; startTagInColumnGroup(p, token); break; case TAG_ID.TR: p.tmplInsertionModeStack[p.tmplInsertionModeStack.length - 1] = InsertionMode.IN_TABLE_BODY; p.insertionMode = InsertionMode.IN_TABLE_BODY; startTagInTableBody(p, token); break; case TAG_ID.TD: case TAG_ID.TH: p.tmplInsertionModeStack[p.tmplInsertionModeStack.length - 1] = InsertionMode.IN_ROW; p.insertionMode = InsertionMode.IN_ROW; startTagInRow(p, token); break; default: p.tmplInsertionModeStack[p.tmplInsertionModeStack.length - 1] = InsertionMode.IN_BODY; p.insertionMode = InsertionMode.IN_BODY; startTagInBody(p, token); } } function endTagInTemplate(p, token) { if (token.tagID === TAG_ID.TEMPLATE) templateEndTagInHead(p, token); } function eofInTemplate(p, token) { if (p.openElements.tmplCount > 0) { do { p.openElements.popUntilTagNamePopped(TAG_ID.TEMPLATE); p.activeFormattingElements.clearToLastMarker(); p.tmplInsertionModeStack.pop(); } while (p.openElements.tmplCount > 0); p._resetInsertionMode(); p.onEof(token); } else stopParsing(p, token); } function startTagAfterBody(p, token) { if (token.tagID === TAG_ID.HTML) startTagInBody(p, token); else tokenAfterBody(p, token); } function endTagAfterBody(p, token) { var _a; if (token.tagID === TAG_ID.HTML) { if (!p.fragmentContext) p.insertionMode = InsertionMode.AFTER_AFTER_BODY; if (p.options.sourceCodeLocationInfo && p.openElements.tagIDs[0] === TAG_ID.HTML) { p._setEndLocation(p.openElements.items[0], token); const bodyElement = p.openElements.items[1]; if (bodyElement && !((_a = p.treeAdapter.getNodeSourceCodeLocation(bodyElement)) === null || _a === void 0 ? void 0 : _a.endTag)) p._setEndLocation(bodyElement, token); } } else tokenAfterBody(p, token); } function tokenAfterBody(p, token) { p.insertionMode = InsertionMode.IN_BODY; modeInBody(p, token); } function startTagInFrameset(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.FRAMESET: p._insertElement(token, NS.HTML); break; case TAG_ID.FRAME: p._appendElement(token, NS.HTML); token.ackSelfClosing = true; break; case TAG_ID.NOFRAMES: startTagInHead(p, token); } } function endTagInFrameset(p, token) { if (token.tagID === TAG_ID.FRAMESET && !p.openElements.isRootHtmlElementCurrent()) { p.openElements.pop(); if (!p.fragmentContext && p.openElements.currentTagId !== TAG_ID.FRAMESET) p.insertionMode = InsertionMode.AFTER_FRAMESET; } } function startTagAfterFrameset(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.NOFRAMES: startTagInHead(p, token); } } function endTagAfterFrameset(p, token) { if (token.tagID === TAG_ID.HTML) p.insertionMode = InsertionMode.AFTER_AFTER_FRAMESET; } function startTagAfterAfterBody(p, token) { if (token.tagID === TAG_ID.HTML) startTagInBody(p, token); else tokenAfterAfterBody(p, token); } function tokenAfterAfterBody(p, token) { p.insertionMode = InsertionMode.IN_BODY; modeInBody(p, token); } function startTagAfterAfterFrameset(p, token) { switch (token.tagID) { case TAG_ID.HTML: startTagInBody(p, token); break; case TAG_ID.NOFRAMES: startTagInHead(p, token); } } function nullCharacterInForeignContent(p, token) { token.chars = "�"; p._insertCharacters(token); } function characterInForeignContent(p, token) { p._insertCharacters(token); p.framesetOk = false; } function popUntilHtmlOrIntegrationPoint(p) { while (p.treeAdapter.getNamespaceURI(p.openElements.current) !== NS.HTML && p.openElements.currentTagId !== void 0 && !p._isIntegrationPoint(p.openElements.currentTagId, p.openElements.current)) p.openElements.pop(); } function startTagInForeignContent(p, token) { if (causesExit(token)) { popUntilHtmlOrIntegrationPoint(p); p._startTagOutsideForeignContent(token); } else { const current = p._getAdjustedCurrentElement(); const currentNs = p.treeAdapter.getNamespaceURI(current); if (currentNs === NS.MATHML) adjustTokenMathMLAttrs(token); else if (currentNs === NS.SVG) { adjustTokenSVGTagName(token); adjustTokenSVGAttrs(token); } adjustTokenXMLAttrs(token); if (token.selfClosing) p._appendElement(token, currentNs); else p._insertElement(token, currentNs); token.ackSelfClosing = true; } } function endTagInForeignContent(p, token) { if (token.tagID === TAG_ID.P || token.tagID === TAG_ID.BR) { popUntilHtmlOrIntegrationPoint(p); p._endTagOutsideForeignContent(token); return; } if (p.openElements.stackTop === 0) return; const { tagName } = token; const adjustedTagName = SVG_TAG_NAMES_ADJUSTMENT_MAP.get(tagName); const contextNs = p.fragmentContext ? p.treeAdapter.getNamespaceURI(p.fragmentContext) : NS.HTML; const i = Math.max(p.openElements.indexOfTopmostByName(NS.SVG, tagName), p.openElements.indexOfTopmostByName(NS.MATHML, tagName), adjustedTagName === void 0 ? -1 : p.openElements.indexOfTopmostByName(NS.SVG, adjustedTagName), contextNs === NS.HTML || contextNs === NS.SVG || contextNs === NS.MATHML ? -1 : p.openElements.indexOfTopmostByName(contextNs, tagName)); if (i > p.openElements.indexOfTopmostHtmlElement()) { token.tagName = p.treeAdapter.getTagName(p.openElements.items[i]); p.openElements.shortenToLength(i); } else p._endTagOutsideForeignContent(token); } // ../../node_modules/.pnpm/parse5@8.1.1/node_modules/parse5/dist/index.js /** * Parses an HTML string. * * @param html Input HTML string. * @param options Parsing options. * @returns Document * * @example * * ```js * const parse5 = require('parse5'); * * const document = parse5.parse('Hi there!'); * * console.log(document.childNodes[1].tagName); //> 'html' *``` */ function parse(html, options) { return Parser.parse(html, options); } export { ERR as ErrorCodes, parse };